DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8850 and snf-5

Sequence 1:NP_725122.2 Gene:CG8850 FlyBaseID:FBgn0033708 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_496735.1 Gene:snf-5 WormBaseID:WBGene00004904 Length:728 Species:Caenorhabditis elegans

Alignment Length:601 Identity:173/602 (29%)
Similarity:290/602 (48%) Gaps:65/602 (11%)


  Fly    44 TINCEAESESSGQRDQWSRGVEFLFSCIALSVGLGNVWRFPFIALENGGGAFLIPYVIVLLLIGR 108
            |::...|.|.. :||.:....||:.:.:.|:|||||:||||..|..|||.||||||:....|.|.
 Worm    70 TLDTPPEEEEE-KRDGFGNSFEFVLTSLGLAVGLGNIWRFPTRAYNNGGSAFLIPYLTCAFLFGL 133

  Fly   109 PVYYLEVIIGQFSSRGCIRAF-DMAPIMRGIAYGQVYSTALATTYYACIMALTIRYLV----ASF 168
            |..|.|.:.||:..:.....| .:.||:.|:.:..|:..||...||..|::....|::    ..|
 Worm   134 PAVYFEFLTGQYQGKSPPVIFRRVRPILEGVGWMGVFVAALVAIYYIVIVSWISIYMINICRGHF 198

  Fly   169 SEVLPWTYCLVEW--GKSC--------------VATGATAANDSSIV----------------QG 201
            :   .|::|..:|  |.||              |...:|..|.|..:                ..
 Worm   199 A---LWSHCNNDWNNGTSCITMADQYLCKNHTKVMANSTLWNSSLPIPDKMVYFNGACQDANGTD 260

  Fly   202 VSSAELFFTQTVLREPES--LDDNGLGTPSWDLVLCLLATWVIIGTILSKGIRSSGKASYFLALF 264
            ||:|...:..|.:.:|.|  ||..|.   :|.:...:...|::.|..:.||.:..||.||...|.
 Worm   261 VSTATEQYFMTYIVQPSSGMLDFGGF---NWPVFAAMSVCWLLTGLGILKGAKIMGKISYVSVLV 322

  Fly   265 PYVIMIVLLIRAVTLPGAWQGI-VYFLKPQWSQLLNPHVWYAAITQMFFSLAICFGTLVMYASFN 328
            |||:::||.|..|...|:..|: :||..|.:::|.....|..|:.|:.|||::..|.|:..:|::
 Worm   323 PYVLVVVLFINGVFQDGSGVGLEMYFGTPNYTKLYEQDTWTEALKQLCFSLSVGHGGLISLSSYS 387

  Fly   329 DFNKNVHKDVIIITTIDSLTSILAGCIIFGILGNLAFETNTKDISQVVKGGAGLAFISYPEAIAK 393
            ....|:.:|.:|:...|:..|::.|..:|..||.||..|. :|:..|||.|..|||:.||||:.:
 Worm   388 PKRNNIFRDALIVIIGDTTMSLVGGGAVFATLGYLAKATG-QDVKDVVKSGLSLAFVVYPEAMTR 451

  Fly   394 FKYLPQLFAVLFFFMLLVLGIGSNIGMASAVVNVVKDRFTHLPH--WLLAVSASIIGFLCGLVYM 456
            .. :|.|:..:||.||.:||..:.|.:.....:.:.|::....:  |::.::...:.:..|||:.
 Worm   452 MP-VPWLWCFIFFLMLFLLGASTEIALVDVFCSCIYDQYPRFRNRKWIVVIAWCSVLYCIGLVFS 515

  Fly   457 TPGGQFVLNLVDFYGCTFIALVLAIAELLAVGWIYGVKRICSDI-EFMLNVKTSF---------Y 511
            |..|.:...:.|.|...|.::...:.|||.:.:|||.:.:..|| |.:.:.:..|         |
 Worm   516 TRAGYYWFEMFDEYAAGFSSVCTVVCELLVMMYIYGFRNVRDDITEVVGHARNKFTGAIGAHSWY 580

  Fly   512 WRICWAIVAPGLMFLVLVYMLFSYE-PLTYRGVQYPPVYYMAGWIIWGLGVLQLPFWALVTIY-- 573
            :...|.:::|.:. |:||.:.|..| |...|...||.|:.:.||.:..|.|:.:|.:.|:...  
 Worm   581 FTANWMVISPSIA-LILVGLSFVREYPYMGRHDIYPAVFDIFGWFLSFLPVIIVPIFMLLNFIRC 644

  Fly   574 QQPGKTFGSKFGLAMQ 589
            :..|.::.:.|.|..|
 Worm   645 RNRGHSYRTLFMLQKQ 660

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8850NP_725122.2 SLC6sbd 58..532 CDD:271359 152/526 (29%)
snf-5NP_496735.1 SLC6sbd 83..601 CDD:271359 152/527 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C102941658
eggNOG 1 0.900 E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.933 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.