DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8850 and slc6a15

Sequence 1:NP_725122.2 Gene:CG8850 FlyBaseID:FBgn0033708 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_002931668.1 Gene:slc6a15 XenbaseID:XB-GENE-975885 Length:730 Species:Xenopus tropicalis

Alignment Length:689 Identity:198/690 (29%)
Similarity:315/690 (46%) Gaps:165/690 (24%)


  Fly    48 EAESESSGQRDQWSRGVEFLFSCIALSVGLGNVWRFPFIALENGGGAFLIPYVIVLLLIGRPVYY 112
            |..|:...:|..|:..::::.:.:..|||||||||||::..:|||||:|:||:|:|||||.||::
 Frog    52 EEGSDIDDERPAWNSKLQYILAQVGFSVGLGNVWRFPYLCQKNGGGAYLVPYLILLLLIGIPVFF 116

  Fly   113 LEVIIGQFSSRGCIRAFD-MAPIMRGIAYGQVYSTALATTYYACIMALTIRYLVASFSEVLPWTY 176
            ||:.:||...||.|..:: ::|.|.||.:...........||..|:..::.|...||...|||..
 Frog   117 LELSVGQRIRRGSIGVWNYISPKMGGIGFASCIVCLFVALYYNVIIGWSLFYFSQSFQHPLPWDQ 181

  Fly   177 C---------LVEWGKSCVATGAT-------AAN-DSSIVQGVSSAELFFTQTVLREPESLDDNG 224
            |         .||  ..|..:.||       |.| .:||.:|                       
 Frog   182 CPLVKNASNTFVE--PECEKSSATTYYWYREALNISNSITEG----------------------- 221

  Fly   225 LGTPSWDLVLCLLATWVIIGTILSKGIRSSGKASYFLALFPYVIMIVLLIRAVTLPGAWQGIVYF 289
             |..:|.:.|||||.|:::...:.|||:||||..||.:|||||::...|:||:.|.|:..||.:.
 Frog   222 -GGLNWKMTLCLLAAWILVCLAMIKGIQSSGKVMYFSSLFPYVVLTCFLVRALLLNGSVDGIRHM 285

  Fly   290 LKPQWSQLLNPHVWYAAITQMFFSLAICFGTLVMYASFNDFNKNVHKDVIIITTIDSLTSILAGC 354
            ..|:...:|.|.||..|.||:||:|.:.||.::.::|:|..:.|.|.|.::::.|:..||:||..
 Frog   286 FTPKLEIMLEPKVWREAATQVFFALGLGFGGVIAFSSYNKRDNNCHFDAVLVSFINFFTSVLATL 350

  Fly   355 IIFGILGNLAFETN-------TKDISQVVK----------------------------------- 377
            ::|.:||   |:.|       :|:..::||                                   
 Frog   351 VVFAVLG---FKANIMNENCISKNTVKIVKYLEAGNLSWSNVPHHVNFSSMSAQDYNLVYYIFQK 412

  Fly   378 ------------------------GGAGLAFISYPEAIAKFKYLPQLFAVLFFFMLLVLGIGSNI 418
                                    .|.|||||::.||:..|...| .::|:||.||:.||:||..
 Frog   413 IKEEEFDSLGLDSCQIEDELNKSVQGTGLAFIAFTEAMTHFPASP-FWSVMFFLMLVNLGLGSMF 476

  Fly   419 GMASAVVNVVKDRFTHLPHWLLAVSASIIGFLCGLVYMTPGGQFVLNLVDFYGCTFIALVLAIAE 483
            |....::..:.|.| .:....|.|...::.|..||:::...|.:.:.:.|.|..|...|::.|.|
 Frog   477 GTIEGIITPIVDTF-KVRKEPLTVGCCLLAFCIGLLFVQRSGNYFVTMFDDYSATLPLLIVVILE 540

  Fly   484 LLAVGWIYGVKRICSDIEFMLNVKTSFYWRICWAIVAPGLMFLVL----VYMLFSYEPLTYRGVQ 544
            .:|:.|:||:.:...|::.||......|:...|..::|.|:.::|    |.|.||          
 Frog   541 NVAIAWVYGIDKFMDDLKDMLGFTPYKYYYYMWKYISPVLLTILLMASIVQMGFS---------- 595

  Fly   545 YPPVYYMAGWII------------WGLGV---------LQLPFWALVTIYQQPGKTFGS------ 582
             ||.||  .||.            |||.|         |.:|...:|........:.||      
 Frog   596 -PPGYY--AWIAEKASEERISYPPWGLAVCISLIVFALLPVPVVFIVRTCNLIDDSTGSLASVSY 657

  Fly   583 KFGLAMQPTANWGPLQTQKFEAYIIHRKREADFKSPRGG 621
            |.|..::.|:|      .:.:|.:||.|.:::..||..|
 Frog   658 KRGKMIKETSN------LEDDASLIHEKIQSEMPSPNIG 690

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8850NP_725122.2 SLC6sbd 58..532 CDD:271359 167/562 (30%)
slc6a15XP_002931668.1 SLC5-6-like_sbd 61..640 CDD:294310 183/623 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C104006333
eggNOG 1 0.900 E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D250396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.