DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8850 and slc6a11b

Sequence 1:NP_725122.2 Gene:CG8850 FlyBaseID:FBgn0033708 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_017213744.2 Gene:slc6a11b ZFINID:ZDB-GENE-121116-2 Length:617 Species:Danio rerio

Alignment Length:617 Identity:216/618 (35%)
Similarity:323/618 (52%) Gaps:48/618 (8%)


  Fly    32 STVIYSAEGEELTINCEAESESS---------GQRDQWSRGVEFLFSCIALSVGLGNVWRFPFIA 87
            |..|.:.:.|| :::.|:.:.|:         .:|.||:..|||:.|.....:|||||||||::.
Zfish     6 SIPIINGKAEE-SMDPESANPSAVRSNDKKVVNERGQWNNKVEFVLSVAGEIIGLGNVWRFPYLC 69

  Fly    88 LENGGGAFLIPYVIVLLLIGRPVYYLEVIIGQFSSRGCIRAF-DMAPIMRGIAYGQVYSTALATT 151
            .:||||||.:||||..:..|.||::||..:|||:|.|.|..: .:.|:..||.|......|....
Zfish    70 YKNGGGAFFVPYVIFFVCCGIPVFFLETALGQFTSEGGITCWRKVCPLFEGIGYATQVIEAHLNV 134

  Fly   152 YYACIMALTIRYLVASFSEVLPWTYCLVEWG-KSCVATGATAANDSSIVQ-----GVSSAELFFT 210
            ||..|:|..|.||...|:..|||..|...|. ::||     ..|:.||..     ..|....|:.
Zfish   135 YYVVILAWAIFYLFNCFTTELPWASCGHYWNTENCV-----DFNNESIANFTNPYSTSPVMEFWE 194

  Fly   211 QTVLREPESLDDNGLGTPSWDLVLCLLATWVIIGTILSKGIRSSGKASYFLALFPYVIMIVLLIR 275
            :.||:....:::  :|...|:|.|||...|||....:.||.:|:||..|..|.|||.::::||:|
Zfish   195 RRVLKISSGIEE--VGGLRWELALCLAIAWVICYFCIWKGPKSTGKVVYVTATFPYFMLLILLLR 257

  Fly   276 AVTLPGAWQGIVYFLKPQWSQLLNPHVWYAAITQMFFSLAICFGTLVMYASFNDFNKNVHKDVII 340
            .:|||||..||.::|.|..|:|.:|.||..|.||:|||.|||.|.|....|:|.:|.|.::|.::
Zfish   258 GITLPGAANGIKFYLYPDISRLSDPQVWVDAGTQIFFSYAICLGCLTALGSYNSYNNNCYRDCLM 322

  Fly   341 ITTIDSLTSILAGCIIFGILGNLAFETNTKDISQVVKGGAGLAFISYPEAIAKFKYLPQLFAVLF 405
            :..::|.||.:||..||.:||.:|:|.|. .|..|.:.|.|||||:||:|:....:.| |:|.||
Zfish   323 LCCLNSGTSFVAGFAIFSVLGFMAYEQNV-PIEAVAESGPGLAFIAYPKAVTMMPWAP-LWAALF 385

  Fly   406 FFMLLVLGIGSNIGMASAVVNVVKDRF-----THLPHWLLAVSASIIGFLCGLVYMTPGGQFVLN 465
            |.||:.||:.|......::|..:.|.:     ......||.:..||..|..||:.:|.||.:|..
Zfish   386 FMMLIFLGLDSQFVCVESLVTAIVDMYPKTFRVGYRRELLILGMSIASFFLGLIMLTEGGMYVFQ 450

  Fly   466 LVDFYGCTFIALV-LAIAELLAVGWIYGVKRICSDIEFMLNVKTSFYWRICWAIVAPGLMFLVLV 529
            |.|.|..:.:.|: :||.|.:.:||:||..|...:||.|:..|..|:.:.||....||:...:.:
Zfish   451 LFDSYAASGMCLLFVAIFESICIGWVYGSDRFYLNIEDMIGYKPIFFIKWCWKFFTPGICTGIFL 515

  Fly   530 YMLFSYEPLTYRGV-QYPPVYYMAGWIIWGLGVLQLPFWALVTIYQQPGKTFGSKFGLAMQPTAN 593
            :.|..|:||.|..| .||...|..||::....::.:|...|..|::..| ||..:......|:|:
Zfish   516 FFLIKYKPLKYNNVYTYPDWGYGIGWMMAMSSMVCIPLGILFQIWKTKG-TFRERIKKLTTPSAD 579

  Fly   594 W---------GPLQTQKFEAYIIHRKREADFK 616
            .         ||......:|     |..||.|
Zfish   580 LRMRGHVASRGPCAINDADA-----KMRADGK 606

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8850NP_725122.2 SLC6sbd 58..532 CDD:271359 183/487 (38%)
slc6a11bXP_017213744.2 SLC5-6-like_sbd 38..576 CDD:320982 201/548 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C107200393
eggNOG 1 0.900 E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D250396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.