DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmF and snrpf

DIOPT Version :8

Sequence 1:NP_523708.2 Gene:SmF / 36314 FlyBaseID:FBgn0000426 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_001005083.1 Gene:snrpf / 448659 XenbaseID:XB-GENE-1017067 Length:86 Species:Xenopus tropicalis

Alignment Length:84 Identity:66/85 (78%)
Similarity:82/85 (96%) Gaps:0/85 (0%)


  Fly     5 MPINPKPFLNGLTGKPVLVKLKWGQEYKGFLVSVDGYMNMQLANTEEVIEGSVTGNLGEVLIRCN 69
            :|:||||||||||||||:||||||.||||:|||||||||||||||||.|:|:::|:|||||||||
 Frog     3 LPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCN 67

  Fly    70 NVLYIKGMEDDDEEGEMRD 88
            |||||:|:|:::|:||||:
 Frog    68 NVLYIRGVEEEEEDGEMRE 86

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmFNP_523708.2 Sm_F 8..76 CDD:212469 58/68 (85%)
snrpfNP_001005083.1 Sm_F 6..74 CDD:212469 58/68 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C266693932
eggNOG 1 0.900 E1_KOG3482
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000660
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.710

Return to query results.
Submit another query.