DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SkpB and SKP1

Sequence 1:NP_610729.1 Gene:SkpB FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_565123.1 Gene:SKP1 AraportID:AT1G75950 Length:160 Species:Arabidopsis thaliana

Alignment Length:155 Identity:85/156 (54%)
Similarity:111/156 (71%) Gaps:4/156 (3%)


  Fly     4 IRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDNSVLPLPNVNSLILKKVLHWATYHKDDPV 68
            |.|:|:|.|.|:.::.:|..|:||...:||  |..||.| |||||.|.||.||:.:...|.:...
plant     6 IVLKSSDGESFEVEEAVALESQTIAHMVED--DCVDNGV-PLPNVTSKILAKVIEYCKRHVEAAA 67

  Fly    69 -VTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMIKGKSPQA 132
             ..|.||......||:.:|||||:|:||.||||||||||||||:.|||:||:|||:|||||:|:.
plant    68 SKAEAVEGAATSDDDLKAWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTVADMIKGKTPEE 132

  Fly   133 IRDTFAIQNDFLPQEEEQVRKENEW 157
            ||.||.|:|||.|:|||:||:||:|
plant   133 IRTTFNIKNDFTPEEEEEVRRENQW 157

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 85/156 (54%)
Skp1 1..110 CDD:214704 53/107 (50%)
Skp1 84..158 CDD:279768 53/75 (71%)
SKP1NP_565123.1 Skp1 3..110 CDD:214704 53/107 (50%)
Skp1 111..158 CDD:307562 31/48 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1529
OMA 1 1.010
OrthoDB 1 1.010 D1412723at2759
OrthoInspector 1 1.000 T32147
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11165
Phylome 1 0.910 0.753 Consistency score
77.080

Return to query results.
Submit another query.