DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SkpB and AT5G42190

Sequence 1:NP_610729.1 Gene:SkpB FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_568603.1 Gene:AT5G42190 AraportID:AT5G42190 Length:171 Species:Arabidopsis thaliana

Alignment Length:171 Identity:86/172 (50%)
Similarity:114/172 (66%) Gaps:26/172 (15%)


  Fly     4 IRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDNSVLPLPNVNSLILKKVLHWATYHKDDPV 68
            |.|:|:|.|.|:.|:.:|..|:||:..|||  |.:||.: |||||.|.||.||:.:...|     
plant     7 ITLKSSDGENFEIDEAVALESQTIKHMIED--DCTDNGI-PLPNVTSKILSKVIEYCKRH----- 63

  Fly    69 VTEEVENKEKRTD-----------------DISSWDADFLKVDQGTLFELILAANYLNIQGLLDV 116
             .|..|..|...|                 |:.:||::|:||||||||:||||||||||:||||:
plant    64 -VEAAEKSETTADAAAATTTTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYLNIKGLLDL 127

  Fly   117 TCKTVANMIKGKSPQAIRDTFAIQNDFLPQEEEQVRKENEW 157
            ||:|||:|||||:|:.||.||.|:|||.|:|||:||:||:|
plant   128 TCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQW 168

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 86/172 (50%)
Skp1 1..110 CDD:214704 53/123 (43%)
Skp1 84..158 CDD:279768 53/75 (71%)
AT5G42190NP_568603.1 Skp1 5..121 CDD:214704 53/123 (43%)
SKP1 6..169 CDD:227528 86/172 (50%)
Skp1 95..169 CDD:279768 53/75 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1529
OMA 1 1.010
OrthoDB 1 1.010 D1412723at2759
OrthoInspector 1 1.000 T32147
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11165
Phylome 1 0.910 0.837 Consistency score
77.080

Return to query results.
Submit another query.