DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and AT5G42190

DIOPT Version :9

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_568603.1 Gene:AT5G42190 / 834224 AraportID:AT5G42190 Length:171 Species:Arabidopsis thaliana


Alignment Length:171 Identity:86/171 - (50%)
Similarity:114/171 - (66%) Gaps:26/171 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDNSVLPLPNVNSLILKKVLHWATYHKDDPV 68
            |.|:|:|.|.|:.|:.:|..|:||:..|||  |.:||.: |||||.|.||.||:.:...|     
plant     7 ITLKSSDGENFEIDEAVALESQTIKHMIED--DCTDNGI-PLPNVTSKILSKVIEYCKRH----- 63

  Fly    69 VTEEVENKEKRTD-----------------DISSWDADFLKVDQGTLFELILAANYLNIQGLLDV 116
             .|..|..|...|                 |:.:||::|:||||||||:||||||||||:||||:
plant    64 -VEAAEKSETTADAAAATTTTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYLNIKGLLDL 127

  Fly   117 TCKTVANMIKGKSPQAIRDTFAIQNDFLPQEEEQVRKENEW 157
            ||:|||:|||||:|:.||.||.|:|||.|:|||:||:||:|
plant   128 TCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQW 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 86/171 (50%)
Skp1 1..110 CDD:214704 52/122 (43%)
Skp1 84..158 CDD:279768 53/74 (72%)
AT5G42190NP_568603.1 BTB_POZ_SKP1 6..136 CDD:349631 63/137 (46%)
Skp1 122..169 CDD:396171 32/47 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 60 1.000 Domainoid score I3858
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - mtm992
orthoMCL 1 0.900 - - OOG6_100934
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.