DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SkpB and SK13

Sequence 1:NP_610729.1 Gene:SkpB FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_567090.1 Gene:SK13 AraportID:AT3G60010 Length:154 Species:Arabidopsis thaliana

Alignment Length:159 Identity:72/160 (45%)
Similarity:100/160 (63%) Gaps:15/160 (9%)


  Fly     3 IIRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDNSVLPLPNVNSLILKKVLHWATYH--KD 65
            ::.|.|:|.|.|..::.:|..|:||...|||  |...|.| |:.||..:||.||:.:...|  .|
plant     4 MVMLLSSDGESFQVEEAVAVQSQTIAHMIED--DCVANGV-PIANVTGVILSKVIEYCKKHVVSD 65

  Fly    66 DPVVTEEVENKEKRTDDISSWDADFLKV--DQGTLFELILAANYLNIQGLLDVTCKTVANMIKGK 128
            .|  |||.:      |::..|||:|:|.  ...|||:::||||||||:.|||:.|:|||:||.||
plant    66 SP--TEESK------DELKKWDAEFMKALEQSSTLFDVMLAANYLNIKDLLDLGCQTVADMITGK 122

  Fly   129 SPQAIRDTFAIQNDFLPQEEEQVRKENEW 157
            .|..||....|:|||.|:|||::||||:|
plant   123 KPDEIRALLGIENDFTPEEEEEIRKENQW 151

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 72/160 (45%)
Skp1 1..110 CDD:214704 44/111 (40%)
Skp1 84..158 CDD:279768 43/77 (56%)
SK13NP_567090.1 Skp1 2..104 CDD:214704 44/111 (40%)
SKP1 4..152 CDD:227528 72/160 (45%)
Skp1 76..152 CDD:279768 43/77 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1529
OMA 1 1.010
OrthoDB 1 1.010 D1412723at2759
OrthoInspector 1 1.000 T32147
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11165
Phylome 1 0.910 0.723 Consistency score
77.080

Return to query results.
Submit another query.