DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SkpB and SK15

Sequence 1:NP_610729.1 Gene:SkpB FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_566773.1 Gene:SK15 AraportID:AT3G25650 Length:177 Species:Arabidopsis thaliana

Alignment Length:163 Identity:72/164 (44%)
Similarity:107/164 (65%) Gaps:13/164 (8%)


  Fly     4 IRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDNSVLPLPNVNSLILKKVLHWATYHKDDPV 68
            |.|.|:|.|.|..::.:|:..:.::..:||  |...|.: ||.||...||..||.:...|.|| |
plant     6 IVLTSSDGESFQVEEVVARKLQIVKHLLED--DCVINEI-PLQNVTGNILSIVLEYCKKHVDD-V 66

  Fly    69 VTEEV--ENKEKRTDD-----ISSWDADFLK-VDQGTLFELILAANYLNIQGLLDVTCKTVANMI 125
            |.::.  |.|:|:.||     :.:|||:|:| :|..|:|:|||||||||::|||.:||:|||:.|
plant    67 VDDDASEEPKKKKPDDEAKQNLDAWDAEFMKNIDMETIFKLILAANYLNVEGLLGLTCQTVADYI 131

  Fly   126 KGKSPQAIRDTFAIQNDFLPQEEEQ-VRKENEW 157
            |.|:|:.:|:.|.|:|||..:|||: :||||.|
plant   132 KDKTPEEVRELFNIENDFTHEEEEEAIRKENAW 164

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 72/164 (44%)
Skp1 1..110 CDD:214704 46/114 (40%)
Skp1 84..158 CDD:279768 43/77 (56%)
SK15NP_566773.1 SKP1 3..165 CDD:227528 72/164 (44%)
Skp1 3..116 CDD:214704 46/114 (40%)
Skp1 89..165 CDD:279768 43/77 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1529
OMA 1 1.010
OrthoDB 1 1.010 D1412723at2759
OrthoInspector 1 1.000 T32147
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11165
Phylome 1 0.910 0.735 Consistency score
77.080

Return to query results.
Submit another query.