DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and SK15

DIOPT Version :9

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_566773.1 Gene:SK15 / 822152 AraportID:AT3G25650 Length:177 Species:Arabidopsis thaliana


Alignment Length:163 Identity:72/163 - (44%)
Similarity:107/163 - (65%) Gaps:13/163 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDNSVLPLPNVNSLILKKVLHWATYHKDDPV 68
            |.|.|:|.|.|..::.:|:..:.::..:||  |...|.: ||.||...||..||.:...|.|| |
plant     6 IVLTSSDGESFQVEEVVARKLQIVKHLLED--DCVINEI-PLQNVTGNILSIVLEYCKKHVDD-V 66

  Fly    69 VTEEV--ENKEKRTDD-----ISSWDADFLK-VDQGTLFELILAANYLNIQGLLDVTCKTVANMI 125
            |.::.  |.|:|:.||     :.:|||:|:| :|..|:|:|||||||||::|||.:||:|||:.|
plant    67 VDDDASEEPKKKKPDDEAKQNLDAWDAEFMKNIDMETIFKLILAANYLNVEGLLGLTCQTVADYI 131

  Fly   126 KGKSPQAIRDTFAIQNDFLPQEEEQ-VRKENEW 157
            |.|:|:.:|:.|.|:|||..:|||: :||||.|
plant   132 KDKTPEEVRELFNIENDFTHEEEEEAIRKENAW 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 72/163 (44%)
Skp1 1..110 CDD:214704 45/113 (40%)
Skp1 84..158 CDD:279768 43/76 (57%)
SK15NP_566773.1 SKP1 3..165 CDD:227528 72/163 (44%)
Skp1 3..116 CDD:214704 45/113 (40%)
Skp1 89..165 CDD:279768 43/76 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - mtm992
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.940

Return to query results.
Submit another query.