DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SkpB and SK3

Sequence 1:NP_610729.1 Gene:SkpB FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_565604.1 Gene:SK3 AraportID:AT2G25700 Length:163 Species:Arabidopsis thaliana

Alignment Length:162 Identity:74/163 (45%)
Similarity:102/163 (63%) Gaps:15/163 (9%)


  Fly     3 IIRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDNSVLPLPNVNSLILKKVLHWATYHKD-- 65
            :|.|:|:|.|.|:.::.:|..|:||:..|||  |..||.: |||||...||.||:.:...|.:  
plant     7 MIILKSSDGESFEVEEAVAVESQTIKHMIED--DCVDNGI-PLPNVTGAILAKVIEYCKKHVEAA 68

  Fly    66 -----DPVVTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMI 125
                 |.......||.|.:|     ||.||:|||..|||:|:.|||||||.||||:|||.||:.:
plant    69 AEAGGDKDFYGSTENHELKT-----WDNDFVKVDHPTLFDLLRAANYLNISGLLDLTCKAVADQM 128

  Fly   126 KGKSPQAIRDTFAIQNDFLPQEEEQVRKENEW 157
            :||:|..:|:.|.|:||:.|:||.:||.||.|
plant   129 RGKTPAQMREHFNIKNDYTPEEEAEVRNENRW 160

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 74/163 (45%)
Skp1 1..110 CDD:214704 48/114 (42%)
Skp1 84..158 CDD:279768 43/75 (57%)
SK3NP_565604.1 Skp1 5..113 CDD:214704 48/114 (42%)
SKP1 7..161 CDD:227528 74/163 (45%)
Skp1 87..161 CDD:279768 44/80 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1412723at2759
OrthoInspector 1 1.000 T32147
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11165
Phylome 1 0.910 0.759 Consistency score
66.030

Return to query results.
Submit another query.