DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SkpB and MEO

Sequence 1:NP_610729.1 Gene:SkpB FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_565467.1 Gene:MEO AraportID:AT2G20160 Length:150 Species:Arabidopsis thaliana

Alignment Length:155 Identity:56/156 (36%)
Similarity:93/156 (60%) Gaps:14/156 (9%)


  Fly     4 IRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDNSVLPLPNVNSLILKKVLHWATYHKDDPV 68
            |.|.|:|.|.|:.|:.:|:..:.:...|:|  |.:|.:: .|.||...||..::.:...|.||  
plant     6 IVLTSSDDECFEIDEAVARKMQMVAHMIDD--DCADKAI-RLQNVTGKILAIIIEYCKKHVDD-- 65

  Fly    69 VTEEVENKEKRTDDISSWDADFLK-VDQGTLFELILAANYLNIQGLLDVTCKTVANMIKGKSPQA 132
                ||.|    ::..:|||:|:| :|..|||:|:.||:||.:.||.::..:.:|:....|:...
plant    66 ----VEAK----NEFVTWDAEFVKNIDMDTLFKLLDAADYLIVIGLKNLIAQAIADYTADKTVNE 122

  Fly   133 IRDTFAIQNDFLPQEEEQVRKENEW 157
            ||:.|.|:||:.|:|||::||:|||
plant   123 IRELFNIENDYTPEEEEELRKKNEW 147

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 56/156 (36%)
Skp1 1..110 CDD:214704 37/107 (35%)
Skp1 84..158 CDD:279768 33/76 (43%)
MEONP_565467.1 Skp1 3..100 CDD:214704 37/107 (35%)
SKP1 5..148 CDD:227528 56/156 (36%)
Skp1 75..148 CDD:279768 33/74 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1412723at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11165
Phylome 1 0.910 0.752 Consistency score
33.020

Return to query results.
Submit another query.