DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SkpB and SK14

Sequence 1:NP_610729.1 Gene:SkpB FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_565296.1 Gene:SK14 AraportID:AT2G03170 Length:149 Species:Arabidopsis thaliana

Alignment Length:155 Identity:67/156 (43%)
Similarity:98/156 (63%) Gaps:15/156 (10%)


  Fly     4 IRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDNSVLPLPNVNSLILKKVLHWATYHKDDPV 68
            |.|.|:|.|.|:.::.:|:..:.:...||   |:...:.:||.||...||..|:.:...|    |
plant     6 IVLSSSDGESFEVEEAVARKLKIVEHMIE---DDCVVTEVPLQNVTGKILSIVVEYCKKH----V 63

  Fly    69 VTEEVENKEKRTDDISSWDADFL-KVDQGTLFELILAANYLNIQGLLDVTCKTVANMIKGKSPQA 132
            |.||       :|:..:||.:|: |.||.|:|:|:||||||||:||||::.:|||:.||.|:|:.
plant    64 VDEE-------SDEFKTWDEEFMKKFDQPTVFQLLLAANYLNIKGLLDLSAQTVADRIKDKTPEE 121

  Fly   133 IRDTFAIQNDFLPQEEEQVRKENEW 157
            ||:.|.|:|||.|:||..|||||.|
plant   122 IREIFNIENDFTPEEEAAVRKENAW 146

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 67/156 (43%)
Skp1 1..110 CDD:214704 39/107 (36%)
Skp1 84..158 CDD:279768 44/76 (58%)
SK14NP_565296.1 SKP1 3..147 CDD:227528 67/156 (43%)
Skp1 3..99 CDD:214704 39/107 (36%)
Skp1 72..147 CDD:279768 44/76 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1529
OMA 1 1.010
OrthoDB 1 1.010 D1412723at2759
OrthoInspector 1 1.000 T32147
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11165
Phylome 1 0.910 0.736 Consistency score
77.080

Return to query results.
Submit another query.