DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SkpB and SK19

Sequence 1:NP_610729.1 Gene:SkpB FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_565295.1 Gene:SK19 AraportID:AT2G03160 Length:200 Species:Arabidopsis thaliana

Alignment Length:185 Identity:71/186 (38%)
Similarity:102/186 (55%) Gaps:34/186 (18%)


  Fly     4 IRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDNSVLPLPNVNSLILKKVLHWATYH---KD 65
            |.|.|:|.|.|..::.:|:..:.:...|||  |.:.|.: |:|||...||.||:.:...|   .|
plant     6 IVLTSSDGESFKVEEVVARKLQIVGHIIED--DCATNKI-PIPNVTGEILAKVIEYCKKHVEDDD 67

  Fly    66 DPVVTEE--------VENKEKRTDDI-------------------SSWDADFLK-VDQGTLFELI 102
            |.|.|.|        ||..:|:.||:                   :.|||.|:| .|..|:|::|
plant    68 DVVETHESSTKGDKTVEEAKKKPDDVAVPESTEGDDEAEDKKEKLNEWDAKFMKDFDIKTIFDII 132

  Fly   103 LAANYLNIQGLLDVTCKTVANMIKGKSPQAIRDTFAIQNDFLPQEEEQVRKENEW 157
            |||||||:|||.|:..||:|:.||..:|:.:|:.|.|:|||.|:|||.:|.||.|
plant   133 LAANYLNVQGLFDLCSKTIADYIKDMTPEEVRELFNIENDFTPEEEEAIRNENAW 187

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 71/186 (38%)
Skp1 1..110 CDD:214704 47/137 (34%)
Skp1 84..158 CDD:279768 40/76 (53%)
SK19NP_565295.1 Skp1 3..140 CDD:214704 47/137 (34%)
SKP1 5..187 CDD:227528 70/184 (38%)
Skp1 114..187 CDD:279768 39/73 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1529
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1412723at2759
OrthoInspector 1 1.000 T32147
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11165
Phylome 1 0.910 0.738 Consistency score
66.070

Return to query results.
Submit another query.