DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SkpB and SKP1

Sequence 1:NP_610729.1 Gene:SkpB FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_733779.1 Gene:SKP1 HGNCID:10899 Length:163 Species:Homo sapiens

Alignment Length:163 Identity:113/164 (69%)
Similarity:134/164 (82%) Gaps:2/164 (1%)


  Fly     1 MPIIRLESADKEIFDTDQEIAKCSETIRIAIEDLG--DESDNSVLPLPNVNSLILKKVLHWATYH 63
            ||.|:|:|:|.|||:.|.||||.|.||:..:||||  ||.|:..:||||||:.|||||:.|.|:|
Human     1 MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHH 65

  Fly    64 KDDPVVTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMIKGK 128
            ||||...|:.||||||||||..||.:|||||||||||||||||||:|:|||||||||||||||||
Human    66 KDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGK 130

  Fly   129 SPQAIRDTFAIQNDFLPQEEEQVRKENEWCEDK 161
            :|:.||.||.|:|||..:||.||||||:|||:|
Human   131 TPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK 163

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 112/162 (69%)
Skp1 1..110 CDD:214704 74/111 (67%)
Skp1 84..158 CDD:279768 57/74 (77%)
SKP1NP_733779.1 BTB_POZ_SKP1 4..127 CDD:349631 86/123 (70%)
Interaction with the F-box domain of F-box proteins. {ECO:0000250} 104..163 45/59 (76%)
Skp1 113..160 CDD:334550 35/47 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C232048075
eggNOG 1 0.900 E1_COG5201
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1412723at2759
OrthoFinder 1 1.000 FOG0000898
OrthoInspector 1 1.000 T608708
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11165
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.