powered by:
Protein Alignment SkpB and skp1
DIOPT Version :9
| Sequence 1: | NP_610729.1 |
Gene: | SkpB / 36298 |
FlyBaseID: | FBgn0026176 |
Length: | 161 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001016519.1 |
Gene: | skp1 / 549273 |
XenbaseID: | XB-GENE-919631 |
Length: | 163 |
Species: | Xenopus tropicalis |
| Alignment Length: | 163 |
Identity: | 113/163 - (69%) |
| Similarity: | 134/163 - (82%) |
Gaps: | 2/163 - (1%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MPIIRLESADKEIFDTDQEIAKCSETIRIAIEDLG--DESDNSVLPLPNVNSLILKKVLHWATYH 63
||.|:|:|:|.|||:.|.||||.|.||:..:|||| ||.|:..:||||||:.|||||:.|.|:|
Frog 1 MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHH 65
Fly 64 KDDPVVTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMIKGK 128
||||...|:.||||||||||..||.:|||||||||||||||||||:|:|||||||||||||||||
Frog 66 KDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGK 130
Fly 129 SPQAIRDTFAIQNDFLPQEEEQVRKENEWCEDK 161
:|:.||.||.|:|||..:||.||||||:|||:|
Frog 131 TPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK 163
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
1 |
1.010 |
- |
- |
|
D1412723at2759 |
| OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000367 |
| OrthoInspector |
1 |
1.000 |
- |
- |
|
otm48533 |
| Panther |
1 |
1.100 |
- |
- |
O |
PTHR11165 |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
1 |
1.000 |
- |
- |
|
X346 |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
5 | 5.110 |
|
Return to query results.
Submit another query.