DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SkpB and skp1

Sequence 1:NP_610729.1 Gene:SkpB FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_957037.1 Gene:skp1 ZFINID:ZDB-GENE-040426-1707 Length:163 Species:Danio rerio

Alignment Length:163 Identity:112/164 (68%)
Similarity:134/164 (82%) Gaps:2/164 (1%)


  Fly     1 MPIIRLESADKEIFDTDQEIAKCSETIRIAIEDLG--DESDNSVLPLPNVNSLILKKVLHWATYH 63
            ||.|:|:|:|.|:|:.|.||||.|.||:..:||||  ||.|:..:||||||:.|||||:.|.|:|
Zfish     1 MPTIKLQSSDGEMFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHH 65

  Fly    64 KDDPVVTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMIKGK 128
            ||||...|:.||||||||||..||.:|||||||||||||||||||:|:|||||||||||||||||
Zfish    66 KDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGK 130

  Fly   129 SPQAIRDTFAIQNDFLPQEEEQVRKENEWCEDK 161
            :|:.||.||.|:|||..:||.||||||:|||:|
Zfish   131 TPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK 163

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 111/162 (69%)
Skp1 1..110 CDD:214704 73/111 (66%)
Skp1 84..158 CDD:279768 57/74 (77%)
skp1NP_957037.1 BTB_POZ_SKP1 3..127 CDD:349631 85/124 (69%)
Skp1 113..160 CDD:334550 35/47 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C232046679
eggNOG 1 0.900 E1_COG5201
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1412723at2759
OrthoFinder 1 1.000 FOG0000898
OrthoInspector 1 1.000 T596258
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11165
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.