DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and skp1

DIOPT Version :9

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_957037.1 Gene:skp1 / 393716 ZFINID:ZDB-GENE-040426-1707 Length:163 Species:Danio rerio


Alignment Length:163 Identity:112/163 - (68%)
Similarity:134/163 - (82%) Gaps:2/163 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPIIRLESADKEIFDTDQEIAKCSETIRIAIEDLG--DESDNSVLPLPNVNSLILKKVLHWATYH 63
            ||.|:|:|:|.|:|:.|.||||.|.||:..:||||  ||.|:..:||||||:.|||||:.|.|:|
Zfish     1 MPTIKLQSSDGEMFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHH 65

  Fly    64 KDDPVVTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMIKGK 128
            ||||...|:.||||||||||..||.:|||||||||||||||||||:|:|||||||||||||||||
Zfish    66 KDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGK 130

  Fly   129 SPQAIRDTFAIQNDFLPQEEEQVRKENEWCEDK 161
            :|:.||.||.|:|||..:||.||||||:|||:|
Zfish   131 TPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 111/161 (69%)
Skp1 1..110 CDD:214704 73/110 (66%)
Skp1 84..158 CDD:279768 56/73 (77%)
skp1NP_957037.1 BTB_POZ_SKP1 3..127 CDD:349631 84/123 (68%)
Skp1 113..160 CDD:396171 34/46 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583351
Domainoid 1 1.000 82 1.000 Domainoid score I8343
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - otm25944
orthoMCL 1 0.900 - - OOG6_100934
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.720

Return to query results.
Submit another query.