DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SkpB and SkpD

Sequence 1:NP_610729.1 Gene:SkpB FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_608357.2 Gene:SkpD FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster

Alignment Length:155 Identity:77/156 (49%)
Similarity:108/156 (69%) Gaps:3/156 (2%)


  Fly     2 PIIRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESD-NSVLPLPNVNSLILKKVLHWATYHKD 65
            |.|:|||:|..||.|:.:.||.||||:..:|....|:| |:|:|||.||:.||.|:|.||.:|||
  Fly     4 PTIKLESSDGVIFSTEVKAAKLSETIKTMLEVSAVENDENAVVPLPKVNAFILNKILTWAYHHKD 68

  Fly    66 DPVVTEEVENKEKRT-DDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMIKGKS 129
            |.....|.|....:: .|||.|||:|:.|||..|||:.:|||||.|:||.|:.|||:||||:||:
  Fly    69 DDDQAAEGEELTPQSPHDISPWDANFINVDQPILFEITVAANYLEIKGLEDLCCKTLANMIRGKT 133

  Fly   130 PQAIRDTFAIQNDFLPQEEEQVRKE 154
            |:.||.||.|::| ||.:..::.::
  Fly   134 PEEIRQTFNIEDD-LPIDTAELGED 157

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 77/156 (49%)
Skp1 1..110 CDD:214704 55/110 (50%)
Skp1 84..158 CDD:279768 38/72 (53%)
SkpDNP_608357.2 Skp1 6..114 CDD:214704 54/108 (50%)
Skp1 88..>147 CDD:279768 36/60 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C231957241
eggNOG 1 0.900 E1_COG5201
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1529
Isobase 1 0.950 0 Normalized mean entropy S272
OrthoDB 1 1.010 D1412723at2759
OrthoFinder 1 1.000 FOG0000898
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11165
RoundUp 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.