powered by:
                   
 
    
    
             
          
            Protein Alignment SkpB and skr-20
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_610729.1 | Gene: | SkpB / 36298 | FlyBaseID: | FBgn0026176 | Length: | 161 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_510192.1 | Gene: | skr-20 / 181445 | WormBaseID: | WBGene00004826 | Length: | 173 | Species: | Caenorhabditis elegans | 
        
        
        
          
            | Alignment Length: | 158 | Identity: | 45/158 - (28%) | 
          
            | Similarity: | 84/158 -  (53%) | Gaps: | 17/158 - (10%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly     2 PIIRLESADKEIFDTDQEIAKCSETIRIAIEDLG------DESDNSVLPLPNVNSLILKKVLHWA 60|:.:|:|.|.:||:.::...|....|.....|.|      :.:|..::|.   :|.|::.|:.|.
 Worm     8 PLYKLKSEDGQIFNVERGPMKFCAFINQKFIDHGVNDRNCERADPILVPF---HSSIVQAVIEWL 69
 
 
  Fly    61 TYHKDDPVVTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMI 125.:::|:|:...:   .:.|..|.|.||..|..|:.|.||.|:.|::.|.::.|:::.|...|.:|
 Worm    70 YHYQDNPLARRD---SKIRYHDFSEWDKQFFNVESGVLFALLNASHALGVEDLMNMGCAAAAELI 131
 
 
  Fly   126 KGKSPQAIRDTFAIQNDFLPQEEEQVRK 153:|||.:.||..:.|::|     |||:.:
 Worm   132 RGKSTEEIRKIYGIRSD-----EEQMEE 154
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 1 | 0.930 | - | - |  | C160160675 | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 1 | 0.900 | - | - |  | E1_COG5201 | 
          
            | Hieranoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 1 | 1.010 | - | - |  | D1412723at2759 | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 1 | 1.100 | - | - | O | PTHR11165 | 
          
            | Phylome | 1 | 0.910 | - | - |  |  | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | SwiftOrtho | 0 | 0.000 | Not matched by this tool. | 
          
            | TreeFam | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 5 | 4.850 |  | 
        
      
           
             Return to query results.
             Submit another query.