DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and skr-20

DIOPT Version :9

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_510192.1 Gene:skr-20 / 181445 WormBaseID:WBGene00004826 Length:173 Species:Caenorhabditis elegans


Alignment Length:158 Identity:45/158 - (28%)
Similarity:84/158 - (53%) Gaps:17/158 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PIIRLESADKEIFDTDQEIAKCSETIRIAIEDLG------DESDNSVLPLPNVNSLILKKVLHWA 60
            |:.:|:|.|.:||:.::...|....|.....|.|      :.:|..::|.   :|.|::.|:.|.
 Worm     8 PLYKLKSEDGQIFNVERGPMKFCAFINQKFIDHGVNDRNCERADPILVPF---HSSIVQAVIEWL 69

  Fly    61 TYHKDDPVVTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMI 125
            .:::|:|:...:   .:.|..|.|.||..|..|:.|.||.|:.|::.|.::.|:::.|...|.:|
 Worm    70 YHYQDNPLARRD---SKIRYHDFSEWDKQFFNVESGVLFALLNASHALGVEDLMNMGCAAAAELI 131

  Fly   126 KGKSPQAIRDTFAIQNDFLPQEEEQVRK 153
            :|||.:.||..:.|::|     |||:.:
 Worm   132 RGKSTEEIRKIYGIRSD-----EEQMEE 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 45/158 (28%)
Skp1 1..110 CDD:214704 31/113 (27%)
Skp1 84..158 CDD:279768 25/70 (36%)
skr-20NP_510192.1 Skp1 7..116 CDD:214704 31/113 (27%)
Skp1 90..154 CDD:279768 25/68 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160675
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.