DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SkpB and skr-3

Sequence 1:NP_610729.1 Gene:SkpB FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_507059.1 Gene:skr-3 WormBaseID:WBGene00004809 Length:167 Species:Caenorhabditis elegans

Alignment Length:162 Identity:82/163 (50%)
Similarity:110/163 (67%) Gaps:9/163 (6%)


  Fly     4 IRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDNS----VLPLPNVNSLILKKVLHWATYHK 64
            |:|.|:|.:.|...:::...|:||...|::||.|...|    .:||..|.|.||:|::.|..:|.
 Worm    10 IKLTSSDDKTFTVSRKVISQSKTITDIIQNLGIEESGSTSEDTIPLQKVTSTILEKIITWCEHHA 74

  Fly    65 DD-PVVTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMIKGK 128
            || |...:|    .|:|.|||.|||:|:|||||||||:|||||||:|:||||||.:.||||:|||
 Worm    75 DDEPKKVDE----NKKTVDISEWDAEFMKVDQGTLFEIILAANYLDIRGLLDVTTQNVANMMKGK 135

  Fly   129 SPQAIRDTFAIQNDFLPQEEEQVRKENEWCED 160
            :|..||..|.|:|||..:|.|.::|||.||||
 Worm   136 TPSQIRTLFNIENDFSEEEREAMKKENAWCED 167

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 82/163 (50%)
Skp1 1..110 CDD:214704 51/111 (46%)
Skp1 84..158 CDD:279768 49/74 (66%)
skr-3NP_507059.1 Skp1 7..117 CDD:214704 51/111 (46%)
SKP1 10..167 CDD:227528 81/161 (50%)
Skp1 91..165 CDD:279768 49/74 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C231961992
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S272
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1412723at2759
OrthoFinder 1 1.000 FOG0000898
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11165
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.