DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SkpB and skr-14

Sequence 1:NP_610729.1 Gene:SkpB FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_504220.4 Gene:skr-14 WormBaseID:WBGene00004820 Length:168 Species:Caenorhabditis elegans

Alignment Length:142 Identity:54/143 (38%)
Similarity:77/143 (54%) Gaps:13/143 (9%)


  Fly    12 EIFDTDQEIAKCSE-------TIRIAIEDLGDESDN----SVLPLPNVNSLILKKVLHWATYHKD 65
            :|...|..:.|.||       |:...||:||...:|    ..:|:.|||...::||..|...|..
 Worm    16 KIISNDGVVTKMSEKAVQQSKTLSNLIENLGYTIENIETRDPIPVTNVNGKTMEKVAEWCEKHNA 80

  Fly    66 DPVVTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMIKGKSP 130
            | .:.|:..|..| |..|..||..|||::...||:||||:|:|:|:||:...||||:||.|||:.
 Worm    81 D-AIPEDNMNVLK-TLTIPEWDQKFLKIEDEALFDLILASNFLDIKGLMYYGCKTVSNMAKGKTT 143

  Fly   131 QAIRDTFAIQND 142
            ..:|:.|.|..|
 Worm   144 AELREIFGINTD 155

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 54/143 (38%)
Skp1 1..110 CDD:214704 38/109 (35%)
Skp1 84..158 CDD:279768 29/60 (48%)
skr-14NP_504220.4 Skp1 12..123 CDD:214704 38/109 (35%)
Skp1 97..161 CDD:279768 29/60 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C231960742
eggNOG 1 0.900 E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S272
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1412723at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11165
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.