DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and skr-9

DIOPT Version :9

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_503043.1 Gene:skr-9 / 178494 WormBaseID:WBGene00004815 Length:194 Species:Caenorhabditis elegans


Alignment Length:163 Identity:60/163 - (36%)
Similarity:88/163 - (53%) Gaps:5/163 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PII-RLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDNSVLPLP--NVNSLILKKVLHWATYH 63
            ||: ::||.|.::|:...|..|.|..:...|.....|...|:.|:|  ||...|||.|:.|...|
 Worm    20 PIMYKVESNDGKVFEISDEAVKQSNILSNLISTCAPEDVASMDPIPITNVIGNILKMVIEWCEKH 84

  Fly    64 KDDPVVTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMIKGK 128
            |.:.:..|: ::..|.. ::..||.:|||:|...||:||:|.|||::.||::..||.||.|..||
 Worm    85 KGEALPVED-DSVPKHV-NVPEWDTNFLKIDNDVLFDLIVACNYLDVPGLMNYGCKIVAMMAIGK 147

  Fly   129 SPQAIRDTFAIQNDFLPQEEEQVRKENEWCEDK 161
            ||..:|..|||..|...:..|:..||....|.|
 Worm   148 SPDELRIIFAIPTDEEDEAAERAAKEKAEAEKK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 59/161 (37%)
Skp1 1..110 CDD:214704 39/110 (35%)
Skp1 84..158 CDD:279768 33/73 (45%)
skr-9NP_503043.1 Skp1 20..129 CDD:214704 39/110 (35%)
Skp1 103..>161 CDD:279768 29/57 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160681
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S272
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.