DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SkpB and skr-9

Sequence 1:NP_610729.1 Gene:SkpB FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_503043.1 Gene:skr-9 WormBaseID:WBGene00004815 Length:194 Species:Caenorhabditis elegans

Alignment Length:163 Identity:60/164 (37%)
Similarity:88/164 (54%) Gaps:5/164 (3%)


  Fly     2 PII-RLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDNSVLPLP--NVNSLILKKVLHWATYH 63
            ||: ::||.|.::|:...|..|.|..:...|.....|...|:.|:|  ||...|||.|:.|...|
 Worm    20 PIMYKVESNDGKVFEISDEAVKQSNILSNLISTCAPEDVASMDPIPITNVIGNILKMVIEWCEKH 84

  Fly    64 KDDPVVTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMIKGK 128
            |.:.:..|: ::..|.. ::..||.:|||:|...||:||:|.|||::.||::..||.||.|..||
 Worm    85 KGEALPVED-DSVPKHV-NVPEWDTNFLKIDNDVLFDLIVACNYLDVPGLMNYGCKIVAMMAIGK 147

  Fly   129 SPQAIRDTFAIQNDFLPQEEEQVRKENEWCEDK 161
            ||..:|..|||..|...:..|:..||....|.|
 Worm   148 SPDELRIIFAIPTDEEDEAAERAAKEKAEAEKK 180

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 59/162 (36%)
Skp1 1..110 CDD:214704 39/111 (35%)
Skp1 84..158 CDD:279768 33/74 (45%)
skr-9NP_503043.1 Skp1 20..129 CDD:214704 39/111 (35%)
Skp1 103..>161 CDD:279768 29/58 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C231962915
eggNOG 1 0.900 E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S272
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1412723at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11165
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.