DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SkpB and skr-13

Sequence 1:NP_610729.1 Gene:SkpB FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_503042.1 Gene:skr-13 WormBaseID:WBGene00004819 Length:172 Species:Caenorhabditis elegans

Alignment Length:155 Identity:55/156 (35%)
Similarity:85/156 (54%) Gaps:6/156 (4%)


  Fly     3 IIRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDN----SVLPLPNVNSLILKKVLHWATYH 63
            :.::.|:|..:....::..:.|:|:...||:||...:|    ..:|:.|||...:.||......|
 Worm    14 VYKIISSDGVVSKMSEKAVQQSKTLSNLIENLGYTIENIETRDPIPVTNVNGKTMAKVAELCEKH 78

  Fly    64 KDDPVVTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMIKGK 128
            |.| .:.|:..|..| |..|..||..|||::...||:||||:|:|:|:||:...||||:||.|||
 Worm    79 KAD-AIPEDNMNVLK-TLTIPEWDQKFLKIEDEALFDLILASNFLDIKGLMYYGCKTVSNMAKGK 141

  Fly   129 SPQAIRDTFAIQNDFLPQEEEQVRK 153
            :...:|:.|.|..|.....||..:|
 Worm   142 TTAELREIFGINTDEQDAAEETAQK 166

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 55/156 (35%)
Skp1 1..110 CDD:214704 36/111 (32%)
Skp1 84..158 CDD:279768 32/71 (45%)
skr-13NP_503042.1 Skp1 12..123 CDD:214704 36/111 (32%)
SKP1 16..166 CDD:227528 54/152 (36%)
Skp1 97..161 CDD:279768 29/64 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C231962650
eggNOG 1 0.900 E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11165
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.