DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SkpB and skr-17

Sequence 1:NP_610729.1 Gene:SkpB FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_495638.1 Gene:skr-17 WormBaseID:WBGene00004823 Length:180 Species:Caenorhabditis elegans

Alignment Length:154 Identity:52/155 (34%)
Similarity:82/155 (53%) Gaps:13/155 (8%)


  Fly     3 IIRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDNSV----LPLPNVNSLILKKVLHWATYH 63
            :::|.|:|..:...|......|.|:...|.:||.:.:...    :|:.||....||.::.|...|
 Worm    24 LLQLTSSDGHLLQGDIRALLLSSTLAATIRELGYDKEYCAELKPVPVNNVVGFTLKLLIEWCDKH 88

  Fly    64 K-DDPVVTEEVENKEKRTDDISSWDADFL-KVDQGTLFELILAANYLNIQGLLDVTCKTVANMIK 126
            | |||.:.  :..|:|:...|.|||..|| ::....||:||.||.:|::.||::..||||||..|
 Worm    89 KEDDPAIA--LAEKDKKNICIPSWDRHFLSRLPMSNLFDLITAAYHLDVTGLINYGCKTVANSAK 151

  Fly   127 GKSPQAIRDTFAIQNDFLPQEEEQ 150
            ||:.:.:|:.|.|     |:..||
 Worm   152 GKNAEEMRELFGI-----PEPWEQ 170

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 52/155 (34%)
Skp1 1..110 CDD:214704 35/113 (31%)
Skp1 84..158 CDD:279768 29/69 (42%)
skr-17NP_495638.1 Skp1 22..135 CDD:214704 35/113 (31%)
Skp1 108..>168 CDD:279768 27/65 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C231961457
eggNOG 1 0.900 E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1412723at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11165
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.