DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SkpB and skr-1

Sequence 1:NP_610729.1 Gene:SkpB FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_492513.1 Gene:skr-1 WormBaseID:WBGene00004807 Length:176 Species:Caenorhabditis elegans

Alignment Length:161 Identity:100/162 (62%)
Similarity:123/162 (76%) Gaps:4/162 (2%)


  Fly     4 IRLESADKEIFDTDQEIAKCSETIRIAIEDLG--DESDNSVLPLP--NVNSLILKKVLHWATYHK 64
            |::.|:|.|||...:.:.:.|.||...:.|||  ||...:..|:|  ||.:.|||||:.|..:|.
 Worm    16 IKISSSDNEIFLVPRNVIRLSNTINTLLMDLGLDDEEGTNAEPIPVQNVTASILKKVISWCNHHH 80

  Fly    65 DDPVVTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMIKGKS 129
            .||:.||:.:|:|||||||.|||.:|||||||||||||||||||:|:||||||||||||||||||
 Worm    81 SDPISTEDSDNREKRTDDIGSWDVEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKS 145

  Fly   130 PQAIRDTFAIQNDFLPQEEEQVRKENEWCED 160
            |:.||.||.|:|||.|:||||:||||.||||
 Worm   146 PEEIRRTFNIKNDFTPEEEEQIRKENAWCED 176

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 100/162 (62%)
Skp1 1..110 CDD:214704 59/110 (54%)
Skp1 84..158 CDD:279768 60/74 (81%)
skr-1NP_492513.1 Skp1 13..126 CDD:214704 59/110 (54%)
SKP1 16..176 CDD:227528 99/160 (62%)
Skp1 101..174 CDD:279768 60/73 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C231962382
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 217 1.000 Inparanoid score I2278
Isobase 1 0.950 0 Normalized mean entropy S272
OMA 1 1.010
OrthoDB 1 1.010 D1412723at2759
OrthoFinder 1 1.000 FOG0000898
OrthoInspector 1 1.000 T98013
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11165
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.960

Return to query results.
Submit another query.