DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpIII128 and RPA135

Sequence 1:NP_523706.1 Gene:RpIII128 FlyBaseID:FBgn0004463 Length:1137 Species:Drosophila melanogaster
Sequence 2:NP_015335.1 Gene:RPA135 SGDID:S000006214 Length:1203 Species:Saccharomyces cerevisiae

Alignment Length:1277 Identity:367/1278 (29%)
Similarity:567/1278 (44%) Gaps:272/1278 (21%)


  Fly    28 IKPLTEKWKLVPAFLQVKGLVKQHIDSFN--------HFINVDIK----KIV-------KANELV 73
            |.|..:|    .||..::..|:.||.|||        ..:|:.:|    |::       ..:|:.
Yeast    26 INPPKDK----SAFPLLQEAVQPHIGSFNALTEGPDGGLLNLGVKDIGEKVIFDGKPLNSEDEIS 86

  Fly    74 TSGADPLFYLKYL---------DVRVGKPDIDDGFN--ITKATTPHECRLRDTTYSAPITVDIEY 127
            .||        ||         .|.:.||..:||.:  :.:...|.|.|.|.|:|...:.:.:::
Yeast    87 NSG--------YLGNKLSVSVEQVSIAKPMSNDGVSSAVERKVYPSESRQRLTSYRGKLLLKLKW 143

  Fly   128 T--RGTQRIKRNNLL----IGRMPLMLRCSNCALTGKSEFELSKLNECPLDPGGYFVVRGQEKVI 186
            :  .|.:     ||.    .|.:|:||:.:.|.|...|.:||.:..|...:.||||:|.|.||:|
Yeast   144 SVNNGEE-----NLFEVRDCGGLPVMLQSNRCHLNKMSPYELVQHKEESDEIGGYFIVNGIEKLI 203

  Fly   187 -------------LIQEQLSWNKMLTEDFNGVVQCQVTSSTHEKKSRTLVLSKHGKYYLKHNSMT 238
                         :|:...: |:..:....|:   |:.|...::.|:|.||     :||....:|
Yeast   204 RMLIVQRRNHPMAIIRPSFA-NRGASYSHYGI---QIRSVRPDQTSQTNVL-----HYLNDGQVT 259

  Fly   239 DD---------IPIVVIFKALGVVSDQEI-QSLIGIDSKSQNRFGASLIDAYNL----------K 283
            ..         :|:|:|.|||...||:|| ..:||.|.|.     :.|.|...|          .
Yeast   260 FRFSWRKNEYLVPVVMILKALCHTSDREIFDGIIGNDVKD-----SFLTDRLELLLRGFKKRYPH 319

  Fly   284 VFTQQRALEYMGSKLVVKRFQSATTKTPSEEARELLLTTILAHVPVDNFNLQMKAIYVSMMVRRV 348
            :..:.:.|:|:|.|..|. ||::..::..|..:|:|...:|.|:..|  ..|.|...:..|:|::
Yeast   320 LQNRTQVLQYLGDKFRVV-FQASPDQSDLEVGQEVLDRIVLVHLGKD--GSQDKFRMLLFMIRKL 381

  Fly   349 MAAELDKTLFDDRDYYGNKRLELAGSLLSMMFEDLFKRMNWELKTIADKNIPKVKAAQFDVVKHM 413
            .:....:...|:.|...::.:.|.|.|..|:.::........:......:|.:..|..|...::|
Yeast   382 YSLVAGECSPDNPDATQHQEVLLGGFLYGMILKEKIDEYLQNIIAQVRMDINRGMAINFKDKRYM 446

  Fly   414 RAA------QITAGLESAISSGNWTIKR-FKMER-AGVTQVLSRLS---YISALGMMTRVNSQFE 467
            ...      .|.:.::..:|:||...:. ..::: :|.|.|..:::   :||...|:.|  ..|.
Yeast   447 SRVLMRVNENIGSKMQYFLSTGNLVSQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHR--GSFF 509

  Fly   468 KTRKVSGPRSLQPSQWGMLCPSDTPEGEACGLVKNLALMTHITTEVEE-RPVMIVAFNAGVEDIR 531
            ...|.:..|.|.|..||.|||..||:|..|||:.:.|....|:|:..: ..:..:.::.||   .
Yeast   510 AQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHFAHKCRISTQQSDVSRIPSILYSLGV---A 571

  Fly   532 EVSGNPINNPNVFLVFINGNVLGLTLNH---KHLVRNLRYMRRKGRMG--------SYVSVHTSY 585
            ..|......|::..|.|:|.::| .::|   |.:...|||.:.:|:..        .||...|..
Yeast   572 PASHTFAAGPSLCCVQIDGKIIG-WVSHEQGKIIADTLRYWKVEGKTPGLPIDLEIGYVPPSTRG 635

  Fly   586 TQRCIYIHTDGGRLCRPYVIVENRRPLVKQHHLDELNRGIRKFDDFLLDGLIEYLDVNEENDSFI 650
            ....:|:.....|:.||          |:...||:        :|.:  |..|.:.:|      |
Yeast   636 QYPGLYLFGGHSRMLRP----------VRYLPLDK--------EDIV--GPFEQVYMN------I 674

  Fly   651 AWNEDQIEDRT-THLEIEPFTLLGVCAGLVPYPHHNQSPRNTYQCAMGKQAMGMIGYNQKNRIDS 714
            |....:|::.. ||:|..|..:|.:.|.|.|:...||||||.|||.||||.||..|....:|.|:
Yeast   675 AVTPQEIQNNVHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDN 739

  Fly   715 LMYNLVYPHAPMVKSKTIELTNFDKLPAGQNATVAVMSYSGYDIEDALILNKASIDRGYGRCLVY 779
            .:|.|.....|:||:...:....|..|.|.||.|||:||:|||::||:|:||::.:||:|...:|
Yeast   740 KLYRLQTGQTPIVKANLYDDYGMDNFPNGFNAVVAVISYTGYDMDDAMIINKSADERGFGYGTMY 804

  Fly   780 KNSKCTVKRYANQTFDRIMGPMKDALTNKVIFKHD--------VLDTDGIVAPGEQVQNKQIM-- 834
            |..|..:....|:         .|.:|....|.:|        .||.||:...|..|:....:  
Yeast   805 KTEKVDLALNRNR---------GDPITQHFGFGNDEWPKEWLEKLDEDGLPYIGTYVEEGDPICA 860

  Fly   835 -----INKEMPAVTSMNPLQGQSAQVPYTAVPISYKGPEPSYIERVMVSANAEEDF----LIKIL 890
                 :||                    |.:. :|...||:|||.|.:..:....|    .:.|.
Yeast   861 YFDDTLNK--------------------TKIK-TYHSSEPAYIEEVNLIGDESNKFQELQTVSIK 904

  Fly   891 LRQTRIPEIGDKFSSRHGQKGVTGLIVEQEDMPFNDFGICPDMIMNPHGFPSRMTVGKTLELLGG 955
            .|..|.|:||||||||||||||........||||::.||.||:|:|||.||||||:|..:|.|.|
Yeast   905 YRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDIIINPHAFPSRMTIGMFVESLAG 969

  Fly   956 KAGLLEGKFHYGTAFGGSKVEDIQA-----ELERHGFNYVGKDFFYSGITGTPLEAYIYSGPVYY 1015
            |||.|.|.....|.:..:: :|..|     :|.:.|:||.|.:..|||.||..|.|.||.|.|||
Yeast   970 KAGALHGIAQDSTPWIFNE-DDTPADYFGEQLAKAGYNYHGNEPMYSGATGEELRADIYVGVVYY 1033

  Fly  1016 QKLKHMVQDKMHARARGPKAVLTRQPTQGRSREGGLRLGEMERDCLISYGASMLIMERLMISSDA 1080
            |:|:|||.||...|:.||...||.||.:||.|.||:|:||||||.||.:|.|.|:.:||:.|||.
Yeast  1034 QRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNSSDY 1098

  Fly  1081 FEVDVCRTCGRM--------------AYCSWCHFCQSSANVSK---------------------- 1109
            .:..|||.||.:              ..|  |..|......:|                      
Yeast  1099 TQASVCRECGSILTTQQSVPRIGSISTVC--CRRCSMRFEDAKKLLTKSEDGEKIFIDDSQIWED 1161

  Fly  1110 --------------ISMPYACKLLFQELTSM------NVVPK 1131
                          :::|:..|.|..||::|      ||.||
Yeast  1162 GQGNKFVGGNETTTVAIPFVLKYLDSELSAMGIRLRYNVEPK 1203

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpIII128NP_523706.1 PRK08565 34..1135 CDD:236291 365/1272 (29%)
RNA_pol_B_RPB2 47..1133 CDD:238353 362/1259 (29%)
RNA_pol_Rpb2_2 210..370 CDD:282427 44/180 (24%)
RNA_pol_Rpb2_4 546..607 CDD:282431 17/72 (24%)
RNA_pol_Rpb2_5 628..668 CDD:282432 10/41 (24%)
RPA135NP_015335.1 RpoB 23..1203 CDD:223163 366/1276 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0085
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.