DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpIII128 and RET1

Sequence 1:NP_523706.1 Gene:RpIII128 FlyBaseID:FBgn0004463 Length:1137 Species:Drosophila melanogaster
Sequence 2:NP_014850.1 Gene:RET1 SGDID:S000005733 Length:1149 Species:Saccharomyces cerevisiae

Alignment Length:1122 Identity:656/1123 (58%)
Similarity:838/1123 (75%) Gaps:27/1123 (2%)


  Fly    28 IKPLTEKWKLVPAFLQVKGLVKQHIDSFNHFINVDIKKIVKANELVTSGADPLFYLKYLDVRVGK 92
            |....:||.|:||||:||||||||:||||:|::.|:|||:|||:|:.|..||.|||||:|:||||
Yeast    38 INTAQDKWHLLPAFLKVKGLVKQHLDSFNYFVDTDLKKIIKANQLILSDVDPEFYLKYVDIRVGK 102

  Fly    93 PDIDDGFNITK--ATTPHECRLRDTTYSAPITVDIEYTRGTQRIKRNNLLIGRMPLMLRCSNCAL 155
            .....    ||  .|.||||||||.||||||.||||||||...|...::.|||||:|||.:.|.|
Yeast   103 KSSSS----TKDYLTPPHECRLRDMTYSAPIYVDIEYTRGRNIIMHKDVEIGRMPIMLRSNKCIL 163

  Fly   156 TGKSEFELSKLNECPLDPGGYFVVRGQEKVILIQEQLSWNKMLTE--DFNGVVQCQVTSSTHEKK 218
            ....|.:::|||||||||||||:|.|.|||||:|||||.|:::.|  :..|:||..|||||||:|
Yeast   164 YDADESKMAKLNECPLDPGGYFIVNGTEKVILVQEQLSKNRIIVEADEKKGIVQASVTSSTHERK 228

  Fly   219 SRTLVLSKHGKYYLKHNSMTDDIPIVVIFKALGVVSDQEIQSLI-GIDSKSQNRFGASLIDAYNL 282
            |:|.|::|:||.||||||:.::|||.::.||.|::||.||..|: |.||..|:.|..:|.::..|
Yeast   229 SKTYVITKNGKIYLKHNSIAEEIPIAIVLKACGILSDLEIMQLVCGNDSSYQDIFAVNLEESSKL 293

  Fly   283 KVFTQQRALEYMGSKLVVKRFQSATTKTPSEEARELLLTTILAHVPVDNFNLQMKAIYVSMMVRR 347
            .::|||:||||:|:|:...|.|..|.   .:|..|.:.||::||:.|:..:.:.||:|::||.||
Yeast   294 DIYTQQQALEYIGAKVKTMRRQKLTI---LQEGIEAIATTVIAHLTVEALDFREKALYIAMMTRR 355

  Fly   348 VMAAELDKTLFDDRDYYGNKRLELAGSLLSMMFEDLFKRMNWELKTIADKNIPKV-KAAQFDVVK 411
            |:.|..:..:.|||||.|||||||||.|:|::||||||:.|.:.|...||.:.|. :|.::|.:.
Yeast   356 VVMAMYNPKMIDDRDYVGNKRLELAGQLISLLFEDLFKKFNNDFKLSIDKVLKKPNRAMEYDALL 420

  Fly   412 --HMRAAQITAGLESAISSGNWTIKRFKMERAGVTQVLSRLSYISALGMMTRVNSQFEKTRKVSG 474
              ::.:..||:||..|||:|||::|||||||||||.||||||||||||||||::|||||:|||||
Yeast   421 SINVHSNNITSGLNRAISTGNWSLKRFKMERAGVTHVLSRLSYISALGMMTRISSQFEKSRKVSG 485

  Fly   475 PRSLQPSQWGMLCPSDTPEGEACGLVKNLALMTHITTEVEERPVMIVAFNAGVEDIREVSGNPIN 539
            ||:|||||:||||.:||||||||||||||||||||||:.||.|:..:.:..|||||     ..|:
Yeast   486 PRALQPSQFGMLCTADTPEGEACGLVKNLALMTHITTDDEEEPIKKLCYVLGVEDI-----TLID 545

  Fly   540 NPNVFL---VFINGNVLGLTLNHKHLVRNLRYMRRKGRMGSYVSVHTSYTQRCIYIHTDGGRLCR 601
            :.::.|   |::||.::|........|...|::||.|::..::|::::..|..::|.|||||:||
Yeast   546 SASLHLNYGVYLNGTLIGSIRFPTKFVTQFRHLRRTGKVSEFISIYSNSHQMAVHIATDGGRICR 610

  Fly   602 PYVIVENRRPLVKQHHLDELNRGIRKFDDFLLDGLIEYLDVNEENDSFIAWNEDQIEDRTTHLEI 666
            |.:||.:.:..||..||.:|..|...|||||..||:|||||||||||:||..|..|....|||||
Yeast   611 PLIIVSDGQSRVKDIHLRKLLDGELDFDDFLKLGLVEYLDVNEENDSYIALYEKDIVPSMTHLEI 675

  Fly   667 EPFTLLGVCAGLVPYPHHNQSPRNTYQCAMGKQAMGMIGYNQKNRIDSLMYNLVYPHAPMVKSKT 731
            ||||:||..|||:|||||||||||||||||||||:|.|.|||..|||:|:|.:.||..||||:||
Yeast   676 EPFTILGAVAGLIPYPHHNQSPRNTYQCAMGKQAIGAIAYNQFKRIDTLLYLMTYPQQPMVKTKT 740

  Fly   732 IELTNFDKLPAGQNATVAVMSYSGYDIEDALILNKASIDRGYGRCLVYKNSKCTVKRYANQTFDR 796
            |||.::|||||||||||||||||||||||||:|||:|||||:|||...:.:...:|||||.|.| 
Yeast   741 IELIDYDKLPAGQNATVAVMSYSGYDIEDALVLNKSSIDRGFGRCETRRKTTTVLKRYANHTQD- 804

  Fly   797 IMGPMKDALTNKVIFKHDVLDTDGIVAPGEQVQNKQIMINKEMP--AVTSMNPLQGQSAQVPYTA 859
            |:|.|:.......|::|..|..||:...|.:||:.||.|||.:|  :..:.|| ...:.|..|..
Yeast   805 IIGGMRVDENGDPIWQHQSLGPDGLGEVGMKVQSGQIYINKSVPTNSADAPNP-NNVNVQTQYRE 868

  Fly   860 VPISYKGPEPSYIERVMVSANAEEDFLIKILLRQTRIPEIGDKFSSRHGQKGVTGLIVEQEDMPF 924
            .|:.|:|||||:|::||:|.:..:..|||:||||.|.||:|||||||||||||.|:||:||||||
Yeast   869 APVIYRGPEPSHIDQVMMSVSDNDQALIKVLLRQNRRPELGDKFSSRHGQKGVCGIIVKQEDMPF 933

  Fly   925 NDFGICPDMIMNPHGFPSRMTVGKTLELLGGKAGLLEGKFHYGTAFGGSKVEDIQAELERHGFNY 989
            ||.||.||:|||||||||||||||.:||:.||||:|.|...|||.|||||:||:...|...||||
Yeast   934 NDQGIVPDIIMNPHGFPSRMTVGKMIELISGKAGVLNGTLEYGTCFGGSKLEDMSKILVDQGFNY 998

  Fly   990 VGKDFFYSGITGTPLEAYIYSGPVYYQKLKHMVQDKMHARARGPKAVLTRQPTQGRSREGGLRLG 1054
            .|||..||||||..|:|||:.||:|||||||||.||||||||||:||||||||:||||:||||||
Yeast   999 SGKDMLYSGITGECLQAYIFFGPIYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLG 1063

  Fly  1055 EMERDCLISYGASMLIMERLMISSDAFEVDVCRTCGRMAYCSWCHFCQSSANVSKISMPYACKLL 1119
            ||||||:|:||||.|::|||||||||||||||..||.|.|..||..|:|:.|:.|:::|||.|||
Yeast  1064 EMERDCVIAYGASQLLLERLMISSDAFEVDVCDKCGLMGYSGWCTTCKSAENIIKMTIPYAAKLL 1128

  Fly  1120 FQELTSMNVVPKMILEN 1136
            ||||.|||:.|::.||:
Yeast  1129 FQELLSMNIAPRLRLED 1145

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpIII128NP_523706.1 PRK08565 34..1135 CDD:236291 654/1114 (59%)
RNA_pol_B_RPB2 47..1133 CDD:238353 643/1099 (59%)
RNA_pol_Rpb2_2 210..370 CDD:282427 76/161 (47%)
RNA_pol_Rpb2_4 546..607 CDD:282431 22/61 (36%)
RNA_pol_Rpb2_5 628..668 CDD:282432 28/40 (70%)
RET1NP_014850.1 RpoB 26..1147 CDD:223163 656/1123 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55641809
eggNOG 1 0.900 E1_COG0085
Hieranoid 1 1.000
Homologene 1 1.000 H6981
Inparanoid 1 1.050 1235 1.000 Inparanoid score I14
Isobase 1 0.950 0 Normalized mean entropy S207
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003638
OrthoInspector 1 1.000 T1135692
orthoMCL 1 0.900 OOG5_126694
Panther 1 1.100 LDO PTHR20856
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1190
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.