DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpIII128 and RPB2

Sequence 1:NP_523706.1 Gene:RpIII128 FlyBaseID:FBgn0004463 Length:1137 Species:Drosophila melanogaster
Sequence 2:NP_014794.3 Gene:RPB2 SGDID:S000005677 Length:1224 Species:Saccharomyces cerevisiae

Alignment Length:1231 Identity:438/1232 (36%)
Similarity:673/1232 (55%) Gaps:143/1232 (12%)


  Fly    17 DPGDSKDWSVPIKPLTEKWKLVPAFLQVKGLVKQHIDSFNHFINVDIKKIVKANELV-------- 73
            ||...:|.|.|| ...:.|.::.||.:.||||.|.:||||.|::..::.|:..:..:        
Yeast    14 DPYGFEDESAPI-TAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQH 77

  Fly    74 TSGADPL---FYLKYLDVRVGKPDIDDGFNITKATTPHECRLRDTTYSAPITVDIEYTRGTQRI- 134
            |:.:|.:   :.:.:..:.|.||.:::...:|.|..|.|.|||:.|||:.:.||:: .|..:.| 
Yeast    78 TTESDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVK-KRTYEAID 141

  Fly   135 -------------------KRNNLLIGRMPLMLRCSNCALTGKSEFELSKLNECPLDPGGYFVVR 180
                               :...:.|||:|:|||..||.|:..:|.:|.||.|||.|.||||::.
Yeast   142 VPGRELKYELIAEESEDDSESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIIN 206

  Fly   181 GQEKVILIQEQLSWNKMLTEDFNGVVQCQVT-----SSTHEKKSR---TLVLSKHGKY------- 230
            |.|||::.||:.:.|  :.:.|.......::     .|..||.||   ||.:..:|:.       
Yeast   207 GSEKVLIAQERSAGN--IVQVFKKAAPSPISHVAEIRSALEKGSRFISTLQVKLYGREGSSARTI 269

  Fly   231 -----YLKHNSMTDDIPIVVIFKALGVVSDQEIQSLIGIDS---KSQNRFGASLIDAYNLKVFTQ 287
                 |:|     .|||||:||:|||::.|.||...|..|.   :........:.|.:.::  .:
Yeast   270 KATLPYIK-----QDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVEDGFVIQ--DR 327

  Fly   288 QRALEYMGSK---LVVKRFQSATTKTPSEEARELLLTTILAHV-PVDNFNLQMKAIYVSMMVRRV 348
            :.||:::|.:   |.:|:      :...:.|:::|....|.|: .::.|. ..||.::..|:.|:
Yeast   328 ETALDFIGRRGTALGIKK------EKRIQYAKDILQKEFLPHITQLEGFE-SRKAFFLGYMINRL 385

  Fly   349 MAAELDKTLFDDRDYYGNKRLELAGSLLSMMFEDLFKRMNWELKTIADKNIPKVKAAQFDVVKHM 413
            :...||:...||||::|.|||:|||.||:.:|:.|||::..::.....:.:.  :|..|::...:
Yeast   386 LLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVE--EAHDFNMKLAI 448

  Fly   414 RAAQITAGLESAISSGNW-TIKRFKMERAGVTQVLSRLSYISALGMMTRVNSQFEKTRKVSGPRS 477
            .|..||:||:.|:::||| ..|:....||||:|||:|.:|.|.|..:.|.|:...:..|::.||.
Yeast   449 NAKTITSGLKYALATGNWGEQKKAMSSRAGVSQVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQ 513

  Fly   478 LQPSQWGMLCPSDTPEGEACGLVKNLALMTHITTEVEERPVMIVAFNAGVEDIREVSGNPINNPN 542
            |..:.||::||::||||:||||||||:||:.|:...:..|::......|:|.:.:..  |..:|:
Yeast   514 LHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSEWGMEPLEDYV--PHQSPD 576

  Fly   543 VFLVFINGNVLGLTLNHKHLVRNLRYMRRKGRMGSYVSVHTSYTQRCIYIHTDGGRLCRPYVIVE 607
            ...||:||...|:..|...|:..||.:||||.:...||:.....::.:.|.||.||:.||..|||
Yeast   577 ATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIVE 641

  Fly   608 NRRPL------VKQHHL--------DELNRGIRKFDDF-----LLDGLIEYLDVNEENDSFIAWN 653
            :...|      |::.|:        .::..|....:::     |.:||:||:|..||....||..
Yeast   642 DDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQ 706

  Fly   654 EDQIEDRT------------------------THLEIEPFTLLGVCAGLVPYPHHNQSPRNTYQC 694
            .:.:|...                        ||.||.|..:|||.|.::|:|.||||||||||.
Yeast   707 PEDLEPAEANEENDLDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQS 771

  Fly   695 AMGKQAMGMIGYNQKNRIDSLMYNLVYPHAPMVKSKTIELTNFDKLPAGQNATVAVMSYSGYDIE 759
            ||||||||:...|...|:|::...|.||..|:..::.:|...|.:|||||||.||:..||||:.|
Yeast   772 AMGKQAMGVFLTNYNVRMDTMANILYYPQKPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQE 836

  Fly   760 DALILNKASIDRGYGRCLVYKNSKCTVKRYA---NQTFDRIMGPMKDALTNKVIFKH---DVLDT 818
            |::|:|::|||||..|.|.:::.....|:|.   .:||::   |.:   ||.:..||   |.||.
Yeast   837 DSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEK---PQR---TNTLRMKHGTYDKLDD 895

  Fly   819 DGIVAPGEQVQNKQIMINKEMPAVTSMNPLQGQSAQVPYTAVPISYKGPEPSYIERVMVSANAEE 883
            ||::|||.:|..:.::|.|..|.......|..::|...........:..|...:::|:|:.|.:.
Yeast   896 DGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG 960

  Fly   884 DFLIKILLRQTRIPEIGDKFSSRHGQKGVTGLIVEQEDMPFNDFGICPDMIMNPHGFPSRMTVGK 948
            ...:|:.:|.|:||:|||||:|||||||..|:...:|||||...||.||:|:|||..||||||..
Yeast   961 LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAH 1025

  Fly   949 TLELLGGKAGLLEGKFHYGTAFGGSKVEDIQAELERHGFNYVGKDFFYSGITGTPLEAYIYSGPV 1013
            .:|.|..|...|.|.....:.|....||.|...|..||:...|.:..|:|.||..|.|.|:.||.
Yeast  1026 LIECLLSKVAALSGNEGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPT 1090

  Fly  1014 YYQKLKHMVQDKMHARARGPKAVLTRQPTQGRSREGGLRLGEMERDCLISYGASMLIMERLMISS 1078
            |||:|:|||.||:|||||||..||||||.:||||:||||.|||||||:|::||:..:.||||.:|
Yeast  1091 YYQRLRHMVDDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAASFLKERLMEAS 1155

  Fly  1079 DAFEVDVCRTCGRMAYCS-------WCHFCQSSANVSKISMPYACKLLFQELTSMNVVPKM 1132
            |||.|.:|..||.|...:       .|..|.:..::.:|.:|||.|||||||.:||:.|::
Yeast  1156 DAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAAKLLFQELMAMNITPRL 1216

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpIII128NP_523706.1 PRK08565 34..1135 CDD:236291 432/1215 (36%)
RNA_pol_B_RPB2 47..1133 CDD:238353 427/1202 (36%)
RNA_pol_Rpb2_2 210..370 CDD:282427 50/187 (27%)
RNA_pol_Rpb2_4 546..607 CDD:282431 24/61 (39%)
RNA_pol_Rpb2_5 628..668 CDD:282432 15/69 (22%)
RPB2NP_014794.3 RNA_pol_Rpb2_7 31..1216 CDD:331952 432/1212 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0085
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126694
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.