DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpIII128 and NRPA2

Sequence 1:NP_523706.1 Gene:RpIII128 FlyBaseID:FBgn0004463 Length:1137 Species:Drosophila melanogaster
Sequence 2:NP_564341.2 Gene:NRPA2 AraportID:AT1G29940 Length:1178 Species:Arabidopsis thaliana

Alignment Length:1289 Identity:350/1290 (27%)
Similarity:562/1290 (44%) Gaps:296/1290 (23%)


  Fly    20 DSKDWSVPIKPLTEKWKLVPAFLQVKGLVKQHIDSFNHFINVDIKKIVKANELVTSGADPLFYLK 84
            ::||.:||         .:..|.::..||..||:||::              :...|.|.:|. :
plant     4 NAKDSTVP---------TMEDFKELHNLVTHHIESFDY--------------MTLKGLDVMFN-R 44

  Fly    85 YLDVRVGKPDIDDGFNI--------------TKATT------PHECRLRDTTYSAPITVDI--EY 127
            ...|.|..|:.::..:|              .|:|:      |.|||....:|:.....|:  :|
plant    45 IKPVSVYDPNTENELSIWLENPLVFAPQKESFKSTSRKEPLLPFECRQAKISYTGTFMADVCFKY 109

  Fly   128 TRGTQRIKRNNLLIGRMPLMLRCSNCALTGKSEFELSKLNECPLDPGGYFVVRGQEKV---ILIQ 189
            ..|.  :.|:....|:.|:||....|:|.|....:|.|..|...:.||||::.|.|:|   ::..
plant   110 NDGV--VVRDKFDFGQFPIMLMSKLCSLKGADCRKLLKCKESTSEMGGYFILNGIERVFRCVIAP 172

  Fly   190 EQLSWNKMLTEDFNG----------VVQCQVTSSTHEKKSRTLVLSKHGKYYLKHNSMTDD---- 240
            ::.....|:...|..          |.:|    ...::.|.|:.|     |||::.|....    
plant   173 KRNHPTSMIRNSFRDRKEGYSSKAVVTRC----VRDDQSSVTVKL-----YYLRNGSARVGFWIV 228

  Fly   241 -----IPIVVIFKALGVVSDQEI-QSLIGIDSKSQNR----FGASLI---------DAYNLKVFT 286
                 :|:.::.|||....|:|| :||....|:...|    .|..|:         :..:|.:||
plant   229 GREYLLPVGLVLKALTNSCDEEIYESLNCCYSEHYGRGDGAIGTQLVRERAKIILDEVRDLGLFT 293

  Fly   287 QQRALEYMGSKLVVKRFQSATTKTPSEE----ARELLLTTILAHVPVDN--FNLQMKAIYVSMMV 345
            :::..:::|     :.||........|.    |..:|...:..|:..|:  |||      :..::
plant   294 REQCRKHLG-----QHFQPVLDGVKKESLSIVAEAVLRDYLFVHLDNDHDKFNL------LIFII 347

  Fly   346 RRVMAAELDKTLFDDRDYYGNKRLELAGSLLSMMFEDLFKRMNW--------------------- 389
            :::.:.....:|.|:.|...|:.:.:.|.::::..::  |...|                     
plant   348 QKLYSLVDQTSLPDNPDSLQNQEILVPGHVITIYLKE--KLEEWLRKCKSLLKDELDNTNSKFSF 410

  Fly   390 ----ELKTIADKNIPKVKAAQFDVVKHMRAAQITAGLESAISSGNWTIKRFKMERAGVTQVLSRL 450
                ::|.:.:||.|:......:.:....|.:..:||:             ..:|||.|....||
plant   411 ESLADVKKLINKNPPRSIGTSIETLLKTGALKTQSGLD-------------LQQRAGYTVQAERL 462

  Fly   451 SYISALGMMTRVN--SQFEKTRKVSGPRSLQPSQWGMLCPSDTPEGEACGLVKNLALMTHITTEV 513
            :::..|.....|:  :.|...|..: .|.|.|..||.|||..||:|..|||:.::...:.||::.
plant   463 NFLRFLSFFRAVHRGASFAGLRTTT-VRKLLPESWGFLCPVHTPDGTPCGLLNHMTRTSRITSQF 526

  Fly   514 E-----------ERPVMIVAFNAGVEDI--REVSGNPINNPNVFLVFINGNVLGLTLNHKHLVRN 565
            :           .:.|:.|...||:...  :.|...|   |.|..|.::|.|:| ||:...:.:.
plant   527 DSKGNIRDFLKIRKSVVDVLTGAGMVPSLPKLVRAGP---PKVIHVLLDGQVVG-TLSSNLVTKV 587

  Fly   566 LRYMRR-KGRMGS---------YVSVHTSYTQRCIYIHTDGGRLCRPYVIVENRRPLVKQHHLDE 620
            :.|:|| |....|         ||......:...:|:.:...|..||          ||...:..
plant   588 VSYIRRLKVEAPSVIPEDLEVGYVPTSMGGSYPGLYLASCPARFIRP----------VKNISIPS 642

  Fly   621 LNRGIRKFDDFLLDGLIE--YLDVN-------EENDSFIAWNEDQIEDRTTHLEIEPFTLLGVCA 676
                    |:..|.|..|  :::::       ..|:|.:|          ||.||.|..::.|.|
plant   643 --------DNIELIGPFEQVFMEISCPDGGNGGRNNSSLA----------THEEIHPTGMISVVA 689

  Fly   677 GLVPYPHHNQSPRNTYQCAMGKQAMGMIGYNQKNRIDSLMYNLVYPHAPMVKSKTIELTNFDKLP 741
            .|.|:..|||||||.|||.|.||.|.......:.|.|..:|:|..|.:|:|::||....:.|:.|
plant   690 NLTPWSDHNQSPRNMYQCQMAKQTMAYSTQALQFRADQKIYHLQTPQSPVVRTKTYTTYSIDENP 754

  Fly   742 AGQNATVAVMSYSGYDIEDALILNKASIDRGYGRCLVYKNSKCTVKRYANQTFDRIMGPMKDALT 806
            .|.||.|||::::|:|:|||:||||:|::||.....:|:.....:.. .|..||......:.: |
plant   755 TGTNAIVAVLAHTGFDMEDAMILNKSSVERGMCHGQIYQTENIDLSD-QNSRFDSGSKSFRRS-T 817

  Fly   807 NKVIFKHDVLDTDGIVAPGEQVQNKQIMINKEMPAVTSMNPLQGQSAQVPYTAV---------PI 862
            ||.  :|..:|.||:.:.|:::...:                       ||.::         .:
plant   818 NKA--EHFRIDADGLPSVGQKLYPDE-----------------------PYCSIYDEVTNKTRHM 857

  Fly   863 SYKGPEPSYIERVMVSANAEE-DFLIKILLRQTRIPEIGDKFSSRHGQKGVTGLIVEQEDMPFND 926
            ..||.:|..::.|.|...::: .....|..|..|.|.||||||||||||||...:....|||||.
plant   858 KRKGTDPVIVDFVSVDMKSKKHPQRANIRFRHARNPIIGDKFSSRHGQKGVCSQLWPDIDMPFNG 922

  Fly   927 F-GICPDMIMNPHGFPSRMTVGKTLELLGGKAGLLEGKFHYGTAF-------GGSK-------VE 976
            . |:.||:|:|||.||||||:...||.:..|.|.|.|||...|.|       .|.:       |:
plant   923 VTGMRPDLIINPHAFPSRMTIAMLLESIAAKGGSLHGKFVDATPFRDAVKKTNGEEESKSSLLVD 987

  Fly   977 DIQAELERHGFNYVGKDFFYSGITGTPLEAYIYSGPVYYQKLKHMVQDKMHARARGPKAVLTRQP 1041
            |:.:.|:..|||:.|.:..|||..|..|:..|:.||||||:|:|||.||...|:.|....||.||
plant   988 DLGSMLKEKGFNHYGTETLYSGYLGVELKCEIFMGPVYYQRLRHMVSDKFQVRSTGQVDQLTHQP 1052

  Fly  1042 TQGRSREGGLRLGEMERDCLISYGASMLIMERLMISSDAFEVDVCRTCGRMAYCS---------- 1096
            .:||.|.||:|.||||||.|:::|||.|:.:||..|||....|||..||.:...|          
plant  1053 IKGRKRGGGIRFGEMERDSLLAHGASYLLHDRLHTSSDHHIADVCSLCGSLLTSSVVNVQQKKLI 1117

  Fly  1097 ---------------WCHFCQSSANVSKISMPYACKLLFQELTSMNVVPKMILE 1135
                           .|:.|::|..:..::|||..:.|..||.|||:  ||.|:
plant  1118 QEIGKLPPGRTPKKVTCYSCKTSKGMETVAMPYVFRYLAAELASMNI--KMTLQ 1169

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpIII128NP_523706.1 PRK08565 34..1135 CDD:236291 346/1274 (27%)
RNA_pol_B_RPB2 47..1133 CDD:238353 344/1259 (27%)
RNA_pol_Rpb2_2 210..370 CDD:282427 38/189 (20%)
RNA_pol_Rpb2_4 546..607 CDD:282431 17/71 (24%)
RNA_pol_Rpb2_5 628..668 CDD:282432 11/49 (22%)
NRPA2NP_564341.2 RpoB 13..1174 CDD:223163 346/1272 (27%)
RNA_pol_B_RPB2 22..1169 CDD:238353 345/1261 (27%)
RNA_pol_Rpb2_2 202..372 CDD:282427 38/186 (20%)
RNA_pol_Rpa2_4 576..628 CDD:284335 11/53 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D42570at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.