DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpIII128 and NRPC2

Sequence 1:NP_523706.1 Gene:RpIII128 FlyBaseID:FBgn0004463 Length:1137 Species:Drosophila melanogaster
Sequence 2:NP_001332060.1 Gene:NRPC2 AraportID:AT5G45140 Length:1161 Species:Arabidopsis thaliana

Alignment Length:1175 Identity:612/1176 (52%)
Similarity:814/1176 (69%) Gaps:66/1176 (6%)


  Fly     2 VELKMGDHNVEATTWDPGDSKDWSVPIKPLTEKWKLVPAFLQVKGLVKQHIDSFNHFINVDIKKI 66
            ::|...||.:        |.:..|.|||...:|::|||.||:|:||||||:||||:||||.|.||
plant     8 LDLTNDDHFI--------DKEKLSAPIKSTADKFQLVPEFLKVRGLVKQHLDSFNYFINVGIHKI 64

  Fly    67 VKANELVTSGADPLFYLKYLDVRVGKPDIDDGFNITKATTPHECRLRDTTYSAPITVDIEYTRGT 131
            ||||..:||..||..||::..||||:|.|.: .|..:...||.|||.|.||:|||.|:|||..|:
plant    65 VKANSRITSTVDPSIYLRFKKVRVGEPSIIN-VNTVENINPHMCRLADMTYAAPIFVNIEYVHGS 128

  Fly   132 QRIK----RNNLLIGRMPLMLRCSNCALTGKSEFELSKLNECPLDPGGYFVVRGQEKVILIQEQL 192
            ...|    ::|::|||||:|||...|.|.||.|.||::|.||||||||||:::|.|||:||||||
plant   129 HGNKAKSAKDNVIIGRMPIMLRSCRCVLHGKDEEELARLGECPLDPGGYFIIKGTEKVLLIQEQL 193

  Fly   193 SWNKMLTE-DFNGVVQCQVTSSTHEKKSRTLVLSKHGKYYLKHNSMTDDIPIVVIFKALGVVSDQ 256
            |.|:::.: |..|.:...|||||...||:|::..:..|.||..:.....|||:::.||:|:.|||
plant   194 SKNRIIIDSDKKGNINASVTSSTEMTKSKTVIQMEKEKIYLFLHRFVKKIPIIIVLKAMGMESDQ 258

  Fly   257 EIQSLIGIDSKSQNRFGASLI----DAYNLKVFTQQRALEYMGSKLVVKRFQSATTKTPSEEARE 317
            ||..::|.|.    ||.|||:    :..:..|.||::||:|:.:|  ||:....|.......|..
plant   259 EIVQMVGRDP----RFSASLLPSIEECVSEGVNTQKQALDYLEAK--VKKISYGTPPEKDGRALS 317

  Fly   318 LLLTTILAHVPVDNFNLQMKAIYVSMMVRRVMAAELDKTLFDDRDYYGNKRLELAGSLLSMMFED 382
            :|....||||||.:.|.:.|..||.:|:||::.|.|:|...||:||.|||||||:|.|:|::|||
plant   318 ILRDLFLAHVPVPDNNFRQKCFYVGVMLRRMIEAMLNKDAMDDKDYVGNKRLELSGQLISLLFED 382

  Fly   383 LFKRMNWELKTIADKNI-----PKVKAAQFD----VVKHMRAAQITAGLESAISSGNWTIKRFKM 438
            |||.|..|    |.||:     ..::|::||    :.|..|.: |:.|||..:|:||:.||||:|
plant   383 LFKTMLSE----AIKNVDHILNKPIRASRFDFSQCLNKDSRYS-ISLGLERTLSTGNFDIKRFRM 442

  Fly   439 ERAGVTQVLSRLSYISALGMMTRVNSQFEKTRKVSGPRSLQPSQWGMLCPSDTPEGEACGLVKNL 503
            .|.|:||||:|||:|.::|.:|:::.||||:|||||||||||||||||||.||||||:|||||||
plant   443 HRKGMTQVLTRLSFIGSMGFITKISPQFEKSRKVSGPRSLQPSQWGMLCPCDTPEGESCGLVKNL 507

  Fly   504 ALMTHITTEVEERPVMIVAFNAGVEDIREVSGNPINNPNVFLVFINGNVLGLTLNHKHLVRNLRY 568
            |||||:||:.||.|::.:.:..||.|:..:|...::.|:.|||.:||.:||.....::...:||.
plant   508 ALMTHVTTDEEEGPLVAMCYKLGVTDLEVLSAEELHTPDSFLVILNGLILGKHSRPQYFANSLRR 572

  Fly   569 MRRKGRMGSYVSVHTSYTQRCIYIHTDGGRLCRPYVIVENRRPLVKQHHLDELNRGIRKFDDFLL 633
            :||.|::|.:|||.|:..|.|:|:.:|.||:|||.||.:.....|||||:.||..|:|.||||:.
plant   573 LRRAGKIGEFVSVFTNEKQHCVYVASDVGRVCRPLVIADKGISRVKQHHMKELQDGVRTFDDFIR 637

  Fly   634 DGLIEYLDVNEENDSFIAWNE-----------DQIEDRTTHLEIEPFTLLGVCAGLVPYPHHNQS 687
            |||||||||||||::.||..|           :..:..|||:||||||:|||.|||:||||||||
plant   638 DGLIEYLDVNEENNALIALYESDGTTELDEGAEAAKADTTHIEIEPFTILGVVAGLIPYPHHNQS 702

  Fly   688 PRNTYQCAMGKQAMGMIGYNQKNRIDSLMYNLVYPHAPMVKSKTIELTNFDKLPAGQNATVAVMS 752
            |||||||||||||||.|.|||.||:|:|:|.||||..|::.::||||..:|||.|||||||||||
plant   703 PRNTYQCAMGKQAMGNIAYNQLNRMDTLLYLLVYPQRPLLTTRTIELVGYDKLGAGQNATVAVMS 767

  Fly   753 YSGYDIEDALILNKASIDRGYGRCLVYKNSKCTVKRYANQTFDRIMGPMKDALTNKVIFKHDVLD 817
            :||||||||:::||:|:|||:|||:|.|......::|.|.|.|||:.|.:   |.....|..:||
plant   768 FSGYDIEDAIVMNKSSLDRGFGRCIVMKKIVAMSQKYDNCTADRILIPQR---TGPDAEKMQILD 829

  Fly   818 TDGIVAPGEQVQNKQIMINKEMPAVTSMNPLQGQSAQVPYTAVPISYKGP--EPSYIERVMVSAN 880
            .||:..|||.::...|.|||::| |.::.......:...|......:|||  |...::||.:.::
plant   830 DDGLATPGEIIRPNDIYINKQVP-VDTVTKFTSALSDSQYRPAREYFKGPEGETQVVDRVALCSD 893

  Fly   881 AEEDFLIKILLRQTRIPEIGDKFSSRHGQKGVTGLIVEQEDMPFNDFGICPDMIMNPHGFPSRMT 945
            .:....||.::|.||.||:|||||||||||||.|:|::|||.||::.|||||:||||||||||||
plant   894 KKGQLCIKYIIRHTRRPELGDKFSSRHGQKGVCGIIIQQEDFPFSELGICPDLIMNPHGFPSRMT 958

  Fly   946 VGKTLELLGGKAGLLEGKFHYGTAFG-----GSKVEDIQAELERHGFNYVGKDFFYSGITGTPLE 1005
            |||.:||||.|||:..|:||||:|||     ..|||.|.|.|...||:|.|||..||||:|.|:|
plant   959 VGKMIELLGSKAGVSCGRFHYGSAFGERSGHADKVETISATLVEKGFSYSGKDLLYSGISGEPVE 1023

  Fly  1006 AYIYSGPVYYQKLKHMVQDKMHARARGPKAVLTRQPTQGRSREGGLRLGEMERDCLISYGASMLI 1070
            |||:.||:|||||||||.||||||..||:.::|||||:|:|:.||||:|||||||||:|||||||
plant  1024 AYIFMGPIYYQKLKHMVLDKMHARGSGPRVMMTRQPTEGKSKNGGLRVGEMERDCLIAYGASMLI 1088

  Fly  1071 MERLMISSDAFEVDVCRTCGRMAYCSW------CHFCQSSANVSKISMPYACKLLFQELTSMNVV 1129
            .||||||||.|||.|||.||.:.|.::      |..|::..|::.:.:|||||||||||.|||||
plant  1089 YERLMISSDPFEVQVCRACGLLGYYNYKLKKAVCTTCKNGDNIATMKLPYACKLLFQELQSMNVV 1153

  Fly  1130 PKMIL 1134
            |::.|
plant  1154 PRLKL 1158

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpIII128NP_523706.1 PRK08565 34..1135 CDD:236291 604/1144 (53%)
RNA_pol_B_RPB2 47..1133 CDD:238353 595/1128 (53%)
RNA_pol_Rpb2_2 210..370 CDD:282427 66/164 (40%)
RNA_pol_Rpb2_4 546..607 CDD:282431 26/61 (43%)
RNA_pol_Rpb2_5 628..668 CDD:282432 26/51 (51%)
NRPC2NP_001332060.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H6981
Inparanoid 1 1.050 1153 1.000 Inparanoid score I23
OMA 1 1.010
OrthoDB 1 1.010 D42570at2759
OrthoInspector 1 1.000 T193044
orthoMCL 1 0.900 OOG5_126694
Panther 1 1.100 LDO PTHR20856
Phylome 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.