DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpIII128 and NRPB2

Sequence 1:NP_523706.1 Gene:RpIII128 FlyBaseID:FBgn0004463 Length:1137 Species:Drosophila melanogaster
Sequence 2:NP_193902.1 Gene:NRPB2 AraportID:AT4G21710 Length:1188 Species:Arabidopsis thaliana

Alignment Length:1183 Identity:432/1184 (36%)
Similarity:668/1184 (56%) Gaps:106/1184 (9%)


  Fly    33 EKWKLVPAFLQVKGLVKQHIDSFNHFINVDIKKIVKANELV-------------TSGADPLFYLK 84
            :.|.::.|:.:.||||:|.:|||:.||...:::||..:..:             :..|:.::.:.
plant    25 DAWAVISAYFEEKGLVRQQLDSFDEFIQNTMQEIVDESADIEIRPESQHNPGHQSDFAETIYKIS 89

  Fly    85 YLDVRVGKPDIDDGFNITKATTPHECRLRDTTYSAPITVDIEYTRGTQR-IKRNN---------- 138
            :..:.:.||.:.:....|....|...|||:.|||||:.||:     |:| ||:.:          
plant    90 FGQIYLSKPMMTESDGETATLFPKAARLRNLTYSAPLYVDV-----TKRVIKKGHDGEEVTETQD 149

  Fly   139 ---LLIGRMPLMLRCSNCALTGKSEFELSKLNECPLDPGGYFVVRGQEKVILIQEQLSWN----- 195
               :.||::|:|||.|.|.|...||.:|::|.|||.|.||||::.|.|||::.||::|.|     
plant   150 FTKVFIGKVPIMLRSSYCTLFQNSEKDLTELGECPYDQGGYFIINGSEKVLIAQEKMSTNHVYVF 214

  Fly   196 -KMLTEDFNGVVQCQVTSSTHEKKSRTLVL----------SKHGKY------YLKHNSMTDDIPI 243
             |.....:..|.:.:..:....:...|:.:          ...|:|      |::     .:|||
plant   215 KKRQPNKYAYVGEVRSMAENQNRPPSTMFVRMLARASAKGGSSGQYIRCTLPYIR-----TEIPI 274

  Fly   244 VVIFKALGVVSDQEIQSLI---GIDSKSQNRFGASLIDAYNLKVFTQQRALEYMGSKLVVKRFQS 305
            :::|:|||.|:|::|...|   ..|::.......||.:|:.::  .|..||:|:|.:       .
plant   275 IIVFRALGFVADKDILEHICYDFADTQMMELLRPSLEEAFVIQ--NQLVALDYIGKR-------G 330

  Fly   306 ATTKTPSEE----ARELLLTTILAHVPVDNFNLQMKAIYVSMMVRRVMAAELDKTLFDDRDYYGN 366
            ||.....|:    ||::|...:|.||.:.......||.|...::.|::...|.:...||||:|||
plant   331 ATVGVTKEKRIKYARDILQKEMLPHVGIGEHCETKKAYYFGYIIHRLLLCALGRRPEDDRDHYGN 395

  Fly   367 KRLELAGSLLSMMFEDLFKRMNWELKTIADKNIPKVKAA--QFDVVKHMRAAQITAGLESAISSG 429
            |||:|||.||..:|..||:::..::::...|.:...|..  ||.:    :|..||:||:.::::|
plant   396 KRLDLAGPLLGGLFRMLFRKLTRDVRSYVQKCVDNGKEVNLQFAI----KAKTITSGLKYSLATG 456

  Fly   430 NWTIKRFKMERAGVTQVLSRLSYISALGMMTRVNSQFEKTRKVSGPRSLQPSQWGMLCPSDTPEG 494
            ||........||||:|||:||:|.|.|..:.|:||...:..|::.||.|..|||||:||::||||
plant   457 NWGQANAAGTRAGVSQVLNRLTYASTLSHLRRLNSPIGREGKLAKPRQLHNSQWGMMCPAETPEG 521

  Fly   495 EACGLVKNLALMTHITTEVEERPVMIVAFNAGVEDIREVSGNPINNPNVFLVFINGNVLGLTLNH 559
            :|||||||||||.:||......|::......|.|:..|:|.:.|  |....:|:||..:|:..:.
plant   522 QACGLVKNLALMVYITVGSAAYPILEFLEEWGTENFEEISPSVI--PQATKIFVNGMWVGVHRDP 584

  Fly   560 KHLVRNLRYMRRKGRMGSYVSVHTSYTQRCIYIHTDGGRLCRPYVIVENRRPLVKQHHLDELNRG 624
            ..||:.||.:||:..:.:.|.|......:.:.|:||.||..||..||:|::.|:|:..:..|.:.
plant   585 DMLVKTLRRLRRRVDVNTEVGVVRDIRLKELRIYTDYGRCSRPLFIVDNQKLLIKKRDIYALQQR 649

  Fly   625 IRKFDD----FLLDGLIEYLDVNEENDSFIAWN-----------EDQIEDRTTHLEIEPFTLLGV 674
            ....:|    .:..|.|||:|..||..:.|:..           |:...:..||.||.|..:|||
plant   650 ESAEEDGWHHLVAKGFIEYIDTEEEETTMISMTISDLVQARLRPEEAYTENYTHCEIHPSLILGV 714

  Fly   675 CAGLVPYPHHNQSPRNTYQCAMGKQAMGMIGYNQKNRIDSLMYNLVYPHAPMVKSKTIELTNFDK 739
            ||.::|:|.||||||||||.||||||||:...|.:.|:|:|.|.|.||..|:|.::.:|..:|.:
plant   715 CASIIPFPDHNQSPRNTYQSAMGKQAMGIYVTNYQFRMDTLAYVLYYPQKPLVTTRAMEHLHFRQ 779

  Fly   740 LPAGQNATVAVMSYSGYDIEDALILNKASIDRGYGRCLVYKNSKCTVKRYANQTFDRIMGPMKDA 804
            ||||.||.||:..||||:.||::|:|::|||||:.|.|.:::.:...|:......:....|.:.:
plant   780 LPAGINAIVAISCYSGYNQEDSVIMNQSSIDRGFFRSLFFRSYRDEEKKMGTLVKEDFGRPDRGS 844

  Fly   805 LTNKVIFKHDVLDTDGIVAPGEQVQNKQIMINKEMPAVTSMNPLQGQSAQVPYTAVPISYKGPEP 869
            ........:|.||.||:..||.:|..:.::|.|..|  .|.:..||||::.......||.:..|.
plant   845 TMGMRHGSYDKLDDDGLAPPGTRVSGEDVIIGKTTP--ISQDEAQGQSSRYTRRDHSISLRHSET 907

  Fly   870 SYIERVMVSANAEEDFLIKILLRQTRIPEIGDKFSSRHGQKGVTGLIVEQEDMPFNDFGICPDMI 934
            ..:::|:::.||:....:|:.:|..|||:|||||||||||||..|:...|||||:...|:.||:|
plant   908 GMVDQVLLTTNADGLRFVKVRVRSVRIPQIGDKFSSRHGQKGTVGMTYTQEDMPWTIEGVTPDII 972

  Fly   935 MNPHGFPSRMTVGKTLELLGGKAGLLEGKFHYGTAFGGSKVEDIQAELERHGFNYVGKDFFYSGI 999
            :|||..|||||:|:.:|.:.||.....||....|.|....|::|...|.:.|:...|.:..|:|.
plant   973 VNPHAIPSRMTIGQLIECIMGKVAAHMGKEGDATPFTDVTVDNISKALHKCGYQMRGFERMYNGH 1037

  Fly  1000 TGTPLEAYIYSGPVYYQKLKHMVQDKMHARARGPKAVLTRQPTQGRSREGGLRLGEMERDCLISY 1064
            ||.||.|.|:.||.|||:|||||.||:|:|.|||..:|||||.:||||:||||.|||||||:|::
plant  1038 TGRPLTAMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIAH 1102

  Fly  1065 GASMLIMERLMISSDAFEVDVCRTCGRMAYCSW------CHFCQSSANVSKISMPYACKLLFQEL 1123
            ||:..:.|||...|||:.|.||..||.:|..:.      |..|::..::.::.:|||||||||||
plant  1103 GAAHFLKERLFDQSDAYRVHVCEVCGLIAIANLKKNSFECRGCKNKTDIVQVYIPYACKLLFQEL 1167

  Fly  1124 TSMNVVPKMILEN 1136
            .||.:.|:|:.::
plant  1168 MSMAIAPRMLTKH 1180

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpIII128NP_523706.1 PRK08565 34..1135 CDD:236291 432/1180 (37%)
RNA_pol_B_RPB2 47..1133 CDD:238353 428/1165 (37%)
RNA_pol_Rpb2_2 210..370 CDD:282427 48/183 (26%)
RNA_pol_Rpb2_4 546..607 CDD:282431 21/61 (34%)
RNA_pol_Rpb2_5 628..668 CDD:282432 14/55 (25%)
NRPB2NP_193902.1 PRK08565 27..1179 CDD:236291 432/1179 (37%)
RNA_pol_B_RPB2 39..1176 CDD:238353 427/1164 (37%)
RNA_pol_Rpb2_4 571..632 CDD:282431 21/61 (34%)
RNA_pol_Rpb2_5 657..708 CDD:282432 13/51 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D42570at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126694
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.