DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpIII128 and Polr3b

Sequence 1:NP_523706.1 Gene:RpIII128 FlyBaseID:FBgn0004463 Length:1137 Species:Drosophila melanogaster
Sequence 2:NP_081699.1 Gene:Polr3b MGIID:1917678 Length:1133 Species:Mus musculus

Alignment Length:1117 Identity:772/1118 (69%)
Similarity:930/1118 (83%) Gaps:6/1118 (1%)


  Fly    25 SVPIKPLTEKWKLVPAFLQVKGLVKQHIDSFNHFINVDIKKIVKANELVTSGADPLFYLKYLDVR 89
            :.||..:.|||:|:||||:|||||||||||||:||||:||||:||||.|||.|||::|||||::.
Mouse    17 TAPIPTVEEKWRLLPAFLKVKGLVKQHIDSFNYFINVEIKKIMKANEKVTSDADPMWYLKYLNIY 81

  Fly    90 VGKPDIDDGFNITKATTPHECRLRDTTYSAPITVDIEYTRGTQRIKRNNLLIGRMPLMLRCSNCA 154
            ||.||:::.||:|:..:||||||||.|||||||||||||||:|||.||.|.|||||:|||.|||.
Mouse    82 VGLPDVEESFNVTRPVSPHECRLRDMTYSAPITVDIEYTRGSQRIIRNALPIGRMPIMLRSSNCV 146

  Fly   155 LTGKSEFELSKLNECPLDPGGYFVVRGQEKVILIQEQLSWNKMLTE-DFNGVVQCQVTSSTHEKK 218
            ||||:..|.:|||||||||||||:|:|.|||||||||||.|:::.| |..|.|...|||||||||
Mouse   147 LTGKTPAEFAKLNECPLDPGGYFIVKGVEKVILIQEQLSKNRIIVEADRKGAVGASVTSSTHEKK 211

  Fly   219 SRTLVLSKHGKYYLKHNSMTDDIPIVVIFKALGVVSDQEIQSLIGIDSKSQNRFGASLIDAYNLK 283
            |||.:..|.|::||:||::::|||||:||||:||.|||||..:||.:......||.||.:....:
Mouse   212 SRTNMAVKQGRFYLRHNTLSEDIPIVIIFKAMGVESDQEIVQMIGTEEHVMAAFGPSLEECQKAQ 276

  Fly   284 VFTQQRALEYMGSKLVVKR-FQSATTKTPSEEARELLLTTILAHVPVDNFNLQMKAIYVSMMVRR 347
            :|||.:||:|:|:|:..:| :.....||..|||||||.:|||.||||..||.:.|.||.::||||
Mouse   277 IFTQMQALKYIGNKVRRQRMWGGGPKKTKIEEARELLASTILTHVPVKEFNFRAKCIYTAVMVRR 341

  Fly   348 VMAAELDKTLFDDRDYYGNKRLELAGSLLSMMFEDLFKRMNWELKTIADKNIPKVKAAQFDVVKH 412
            |:.|:.|..: |||||||||||||||.|||::||||||:.|.|:|.|||:.|||.:|||||||||
Mouse   342 VILAQGDNKV-DDRDYYGNKRLELAGQLLSLLFEDLFKKFNSEMKKIADQVIPKQRAAQFDVVKH 405

  Fly   413 MRAAQITAGLESAISSGNWTIKRFKMERAGVTQVLSRLSYISALGMMTRVNSQFEKTRKVSGPRS 477
            ||..|||.|:.:|||:|||::|||||:|.||||||||||||||||||||::||||||||||||||
Mouse   406 MRQDQITNGMVNAISTGNWSLKRFKMDRQGVTQVLSRLSYISALGMMTRISSQFEKTRKVSGPRS 470

  Fly   478 LQPSQWGMLCPSDTPEGEACGLVKNLALMTHITTEVEERPVMIVAFNAGVEDIREVSGNPINNPN 542
            ||||||||||||||||||||||||||||||||||::|:.|::.:|.|.||||:..:.|..::.||
Mouse   471 LQPSQWGMLCPSDTPEGEACGLVKNLALMTHITTDMEDGPIIKLAGNLGVEDVNLLCGEELSYPN 535

  Fly   543 VFLVFINGNVLGLTLNHKHLVRNLRYMRRKGRMGSYVSVHTSYTQRCIYIHTDGGRLCRPYVIVE 607
            |||||:|||:||:..:||.||...|.|||.|.:..:||:.|:.|.||:||.:|||||||||:||:
Mouse   536 VFLVFLNGNILGVIRDHKKLVSTFRLMRRAGYINEFVSISTNLTDRCVYISSDGGRLCRPYIIVK 600

  Fly   608 NRRPLVKQHHLDELNRGIRKFDDFLLDGLIEYLDVNEENDSFIAWNEDQIEDRTTHLEIEPFTLL 672
            .::|.|...|::||.:|.|.|:|||.:.|:||||||||||..||..|..|...||||||||||||
Mouse   601 KQKPAVTNKHMEELAQGYRNFEDFLHESLVEYLDVNEENDCNIALYEHTINKDTTHLEIEPFTLL 665

  Fly   673 GVCAGLVPYPHHNQSPRNTYQCAMGKQAMGMIGYNQKNRIDSLMYNLVYPHAPMVKSKTIELTNF 737
            ||||||:|||||||||||||||||||||||.|||||:||||:|||.|.||..||||:|||||.:|
Mouse   666 GVCAGLIPYPHHNQSPRNTYQCAMGKQAMGTIGYNQRNRIDTLMYLLAYPQKPMVKTKTIELIDF 730

  Fly   738 DKLPAGQNATVAVMSYSGYDIEDALILNKASIDRGYGRCLVYKNSKCTVKRYANQTFDRIMGPMK 802
            :||||||||||||||||||||||||:|||||:|||:||||||||:|||:|||.|||||::||||.
Mouse   731 EKLPAGQNATVAVMSYSGYDIEDALVLNKASLDRGFGRCLVYKNAKCTLKRYTNQTFDKVMGPML 795

  Fly   803 DALTNKVIFKHDVLDTDGIVAPGEQVQNKQIMINKEMPAVTSMNPLQGQSA--QVPYTAVPISYK 865
            ||.|.|.|::|::||.|||.:|||:|:|||:::||.||.||.: ||:|.:.  |..|..|||:||
Mouse   796 DAATRKPIWRHEILDADGICSPGEKVENKQVLVNKSMPTVTQI-PLEGSNVPQQPQYKDVPITYK 859

  Fly   866 GPEPSYIERVMVSANAEEDFLIKILLRQTRIPEIGDKFSSRHGQKGVTGLIVEQEDMPFNDFGIC 930
            |...||||:||:|:|||:.||||:||||||.||||||||||||||||.||||.||||||.|.|||
Mouse   860 GATDSYIEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVCGLIVPQEDMPFCDSGIC 924

  Fly   931 PDMIMNPHGFPSRMTVGKTLELLGGKAGLLEGKFHYGTAFGGSKVEDIQAELERHGFNYVGKDFF 995
            ||:|||||||||||||||.:|||.||||:|:|:||||||||||||:|:..:|.|||:||:|||:.
Mouse   925 PDIIMNPHGFPSRMTVGKLIELLAGKAGVLDGRFHYGTAFGGSKVKDVCEDLVRHGYNYLGKDYV 989

  Fly   996 YSGITGTPLEAYIYSGPVYYQKLKHMVQDKMHARARGPKAVLTRQPTQGRSREGGLRLGEMERDC 1060
            .|||||.|||||||.||||||||||||.||||||||||:||||||||:||||:||||||||||||
Mouse   990 TSGITGEPLEAYIYFGPVYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDC 1054

  Fly  1061 LISYGASMLIMERLMISSDAFEVDVCRTCGRMAYCSWCHFCQSSANVSKISMPYACKLLFQELTS 1125
            ||.||||||::|||||||||||||||..||.:.|..|||:|:||.:||.:.:|||||||||||.|
Mouse  1055 LIGYGASMLLLERLMISSDAFEVDVCGQCGLLGYSGWCHYCKSSCHVSSLRIPYACKLLFQELQS 1119

  Fly  1126 MNVVPKMILENY 1137
            ||::|::.|..|
Mouse  1120 MNIIPRLKLAKY 1131

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpIII128NP_523706.1 PRK08565 34..1135 CDD:236291 768/1105 (70%)
RNA_pol_B_RPB2 47..1133 CDD:238353 757/1090 (69%)
RNA_pol_Rpb2_2 210..370 CDD:282427 88/161 (55%)
RNA_pol_Rpb2_4 546..607 CDD:282431 35/61 (57%)
RNA_pol_Rpb2_5 628..668 CDD:282432 26/40 (65%)
Polr3bNP_081699.1 PRK08565 26..1129 CDD:236291 768/1105 (70%)
RNA_pol_B_RPB2 39..1127 CDD:238353 757/1090 (69%)
RNA_pol_Rpb2_4 539..600 CDD:282431 35/61 (57%)
RNA_pol_Rpb2_5 621..661 CDD:282432 26/40 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55635784
eggNOG 1 0.900 E1_COG0085
Hieranoid 1 1.000
Homologene 1 1.000 H6981
Inparanoid 1 1.050 1589 1.000 Inparanoid score I84
Isobase 1 0.950 0 Normalized mean entropy S207
OMA 1 1.010
OrthoDB 1 1.010 D42570at2759
OrthoFinder 1 1.000 FOG0003638
OrthoInspector 1 1.000 T1082684
orthoMCL 1 0.900 OOG5_126694
Panther 1 1.100 LDO PTHR20856
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1190
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.