DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpIII128 and polr3b

Sequence 1:NP_523706.1 Gene:RpIII128 FlyBaseID:FBgn0004463 Length:1137 Species:Drosophila melanogaster
Sequence 2:XP_021323450.1 Gene:polr3b ZFINID:ZDB-GENE-030131-2887 Length:1130 Species:Danio rerio

Alignment Length:1116 Identity:769/1117 (69%)
Similarity:927/1117 (83%) Gaps:5/1117 (0%)


  Fly    25 SVPIKPLTEKWKLVPAFLQVKGLVKQHIDSFNHFINVDIKKIVKANELVTSGADPLFYLKYLDVR 89
            :.|:..:.|||||:||||:|||||||||||||:||||:||||:||||.:||.|||::|||||::.
Zfish    15 AAPVDTVEEKWKLLPAFLKVKGLVKQHIDSFNYFINVEIKKIMKANEKITSDADPMWYLKYLNIY 79

  Fly    90 VGKPDIDDGFNITKATTPHECRLRDTTYSAPITVDIEYTRGTQRIKRNNLLIGRMPLMLRCSNCA 154
            ||.||:::.||:|:..:||||||||.|||||||||||||||:|||.||.|.|||||:|||.|||.
Zfish    80 VGMPDVEESFNVTRPVSPHECRLRDMTYSAPITVDIEYTRGSQRIIRNALPIGRMPIMLRSSNCV 144

  Fly   155 LTGKSEFELSKLNECPLDPGGYFVVRGQEKVILIQEQLSWNKMLT-EDFNGVVQCQVTSSTHEKK 218
            ||||:..|.||||||||||||||:|:|||||||||||||.|:::. :|..|.|...|||||||||
Zfish   145 LTGKTPMEFSKLNECPLDPGGYFIVKGQEKVILIQEQLSKNRIIVDQDRKGTVGASVTSSTHEKK 209

  Fly   219 SRTLVLSKHGKYYLKHNSMTDDIPIVVIFKALGVVSDQEIQSLIGIDSKSQNRFGASLIDAYNLK 283
            |||.::.|.|::|||||::::|.||.:||||:||.|||||..:||.:......|..||.:....:
Zfish   210 SRTNMIVKQGRFYLKHNTLSEDAPIAIIFKAMGVESDQEIVQMIGTEEHVMAAFAPSLEECQKAQ 274

  Fly   284 VFTQQRALEYMGSKLVVKRFQSATTKTPSEEARELLLTTILAHVPVDNFNLQMKAIYVSMMVRRV 348
            :|||.:||.|:|:|:..:|......||..|||||||.:|||.||||..||.:.|.||:::|||||
Zfish   275 IFTQTQALRYIGNKVRRQRMWGGPKKTKMEEARELLASTILTHVPVKEFNFRAKCIYLAVMVRRV 339

  Fly   349 MAAELDKTLFDDRDYYGNKRLELAGSLLSMMFEDLFKRMNWELKTIADKNIPKVKAAQFDVVKHM 413
            :.|:.|..: |||||||||||||||.|||::||||||:.|.|||.|||:.|||.:||||||||||
Zfish   340 ILAQGDNKV-DDRDYYGNKRLELAGQLLSLLFEDLFKKFNSELKKIADQIIPKQRAAQFDVVKHM 403

  Fly   414 RAAQITAGLESAISSGNWTIKRFKMERAGVTQVLSRLSYISALGMMTRVNSQFEKTRKVSGPRSL 478
            |..|||.|:.:|||:|||::|||||:|.||||||||||:|||||||||::|||||||||||||||
Zfish   404 RQDQITNGMVNAISTGNWSLKRFKMDRQGVTQVLSRLSFISALGMMTRISSQFEKTRKVSGPRSL 468

  Fly   479 QPSQWGMLCPSDTPEGEACGLVKNLALMTHITTEVEERPVMIVAFNAGVEDIREVSGNPINNPNV 543
            |||||||||||||||||||||||||||||||||::|:.|::.:|||.||||:..:.|..::.|.|
Zfish   469 QPSQWGMLCPSDTPEGEACGLVKNLALMTHITTDMEDGPIIKLAFNLGVEDVNLLCGEELSYPTV 533

  Fly   544 FLVFINGNVLGLTLNHKHLVRNLRYMRRKGRMGSYVSVHTSYTQRCIYIHTDGGRLCRPYVIVEN 608
            ||||:|||:||:..:|:.||...|.|||.|.:..:||:.|:.|.||:||.:|||||||||:||:|
Zfish   534 FLVFLNGNILGVIRDHQKLVYTFRLMRRAGFINEFVSISTNLTDRCVYISSDGGRLCRPYIIVKN 598

  Fly   609 RRPLVKQHHLDELNRGIRKFDDFLLDGLIEYLDVNEENDSFIAWNEDQIEDRTTHLEIEPFTLLG 673
            .:|.||..|::||::|.|.|:|||.:.|:||||||||||..||..|..|...|||||||||||||
Zfish   599 GKPAVKNKHIEELSQGYRTFEDFLHESLVEYLDVNEENDCNIALYEHMISKDTTHLEIEPFTLLG 663

  Fly   674 VCAGLVPYPHHNQSPRNTYQCAMGKQAMGMIGYNQKNRIDSLMYNLVYPHAPMVKSKTIELTNFD 738
            |||||:|||||||||||||||||||||||.|||||:||||:|||.|.||..||||:|||||.:|:
Zfish   664 VCAGLIPYPHHNQSPRNTYQCAMGKQAMGTIGYNQRNRIDTLMYLLAYPQRPMVKTKTIELIDFE 728

  Fly   739 KLPAGQNATVAVMSYSGYDIEDALILNKASIDRGYGRCLVYKNSKCTVKRYANQTFDRIMGPMKD 803
            ||||||||||||||||||||||||:|||||:|||:||||||||:|||::||.|||||::||||.|
Zfish   729 KLPAGQNATVAVMSYSGYDIEDALVLNKASLDRGFGRCLVYKNAKCTLRRYTNQTFDKVMGPMLD 793

  Fly   804 ALTNKVIFKHDVLDTDGIVAPGEQVQNKQIMINKEMPAVTSMNPLQG--QSAQVPYTAVPISYKG 866
            |.|.|.|::|.:||.|||.:|||:|:|||:::||.||.|| ..||:|  |..|..|..||:||||
Zfish   794 AETRKPIWRHSILDADGICSPGEKVENKQVLVNKSMPTVT-QTPLEGSAQPGQPQYREVPVSYKG 857

  Fly   867 PEPSYIERVMVSANAEEDFLIKILLRQTRIPEIGDKFSSRHGQKGVTGLIVEQEDMPFNDFGICP 931
            ...||||:||:|:|||:.||:||||||||.||||||||||||||||.||||.||||||.|.||||
Zfish   858 ATDSYIEKVMISSNAEDAFLVKILLRQTRRPEIGDKFSSRHGQKGVCGLIVPQEDMPFCDSGICP 922

  Fly   932 DMIMNPHGFPSRMTVGKTLELLGGKAGLLEGKFHYGTAFGGSKVEDIQAELERHGFNYVGKDFFY 996
            |:||||||:||||||||.:|||.||||:|:|:||||||||||||:|:..:|.|:|:||.|||:..
Zfish   923 DIIMNPHGYPSRMTVGKLIELLAGKAGVLDGRFHYGTAFGGSKVKDVCEDLIRYGYNYQGKDYVT 987

  Fly   997 SGITGTPLEAYIYSGPVYYQKLKHMVQDKMHARARGPKAVLTRQPTQGRSREGGLRLGEMERDCL 1061
            |||||.|||||||.||||||||||||.||||||||||:||||||||:||||:|||||||||||||
Zfish   988 SGITGEPLEAYIYFGPVYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCL 1052

  Fly  1062 ISYGASMLIMERLMISSDAFEVDVCRTCGRMAYCSWCHFCQSSANVSKISMPYACKLLFQELTSM 1126
            |.||||||::|||||||||||||||..||.:.|..|||:|:||.:||.:.:|||||||||||.||
Zfish  1053 IGYGASMLLLERLMISSDAFEVDVCGQCGLLGYSGWCHYCKSSCHVSSLRIPYACKLLFQELQSM 1117

  Fly  1127 NVVPKMILENY 1137
            |::|::.|..|
Zfish  1118 NIIPRLKLARY 1128

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpIII128NP_523706.1 PRK08565 34..1135 CDD:236291 766/1104 (69%)
RNA_pol_B_RPB2 47..1133 CDD:238353 754/1089 (69%)
RNA_pol_Rpb2_2 210..370 CDD:282427 86/160 (54%)
RNA_pol_Rpb2_4 546..607 CDD:282431 34/61 (56%)
RNA_pol_Rpb2_5 628..668 CDD:282432 26/40 (65%)
polr3bXP_021323450.1 RNA_pol_B_RPB2 37..1124 CDD:238353 754/1089 (69%)
RNA_pol_Rpb2_4 536..597 CDD:309626 34/61 (56%)
RNA_pol_Rpb2_5 618..658 CDD:309627 26/40 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55637690
eggNOG 1 0.900 E1_COG0085
Hieranoid 1 1.000
Homologene 1 1.000 H6981
Inparanoid 1 1.050 1576 1.000 Inparanoid score I81
OMA 1 1.010
OrthoDB 1 1.010 D42570at2759
OrthoFinder 1 1.000 FOG0003638
OrthoInspector 1 1.000 T1052020
orthoMCL 1 0.900 OOG5_126694
Panther 1 1.100 LDO PTHR20856
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1190
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.