DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpIII128 and POLR2B

Sequence 1:NP_523706.1 Gene:RpIII128 FlyBaseID:FBgn0004463 Length:1137 Species:Drosophila melanogaster
Sequence 2:NP_000929.1 Gene:POLR2B HGNCID:9188 Length:1174 Species:Homo sapiens

Alignment Length:1169 Identity:436/1170 (37%)
Similarity:686/1170 (59%) Gaps:93/1170 (8%)


  Fly    35 WKLVPAFLQVKGLVKQHIDSFNHFINVDIKKIV--------KANELVTSG---ADPLFYLKYLDV 88
            |.::.::...||||:|.:|||:.||.:.:::||        :|.....||   ..|.:.||:..:
Human    27 WIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPIDLQAEAQHASGEVEEPPRYLLKFEQI 91

  Fly    89 RVGKPDIDDGFNITKATTPHECRLRDTTYSAPITVDIEYT---RGTQRI--KRNNLLIGRMPLML 148
            .:.||...:.........|:|.|||:.|||||:.|||..|   .|.:::  :.....||::|:||
Human    92 YLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIML 156

  Fly   149 RCSNCALTGKSEFELSKLNECPLDPGGYFVVRGQEKVILIQEQLSWNKMLT---ED----FNGVV 206
            |.:.|.|.|.::.:|.:||||||||||||::.|.|||::.||:::.|.:..   :|    :.|  
Human   157 RSTYCLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTG-- 219

  Fly   207 QCQVTSSTHEKKSRTL---VLSKHGK---------------YYLKHNSMTDDIPIVVIFKALGVV 253
            :|:.......:.:.|:   :|::.|:               .|:|     .::||:::|:|||.|
Human   220 ECRSCLENSSRPTSTIWVSMLARGGQGAKKSAIGQRIVATLPYIK-----QEVPIIIVFRALGFV 279

  Fly   254 SDQEIQSLIGI---DSKSQNRFGASLIDAYNLKVFTQQRALEYMGSKLVVKRFQSATTKTPSEEA 315
            ||::|...|..   |.:.......||.:|:.::  .|..||.::||:   ......|.:...:.|
Human   280 SDRDILEHIIYDFEDPEMMEMVKPSLDEAFVIQ--EQNVALNFIGSR---GAKPGVTKEKRIKYA 339

  Fly   316 RELLLTTILAHVPVDNFNLQMKAIYVSMMVRRVMAAELDKTLFDDRDYYGNKRLELAGSLLSMMF 380
            :|:|...:|.||.|.:|....||.::..||.|::.|.|.:...||||:||||||:|||.||:.:|
Human   340 KEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLF 404

  Fly   381 EDLFKRMNWELKTIADKNIPKVKAAQFDVVKHMRAAQITAGLESAISSGNW-TIKRFKMERAGVT 444
            ..:||.:..|::..|.|.|.:.|  .|::...::...|:.||:.::::||| ..|:....||||:
Human   405 RGMFKNLLKEVRIYAQKFIDRGK--DFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVS 467

  Fly   445 QVLSRLSYISALGMMTRVNSQFEKTRKVSGPRSLQPSQWGMLCPSDTPEGEACGLVKNLALMTHI 509
            |||:||::.|.|..:.|:||...:..|::.||.|..:.|||:||::||||.|.|||||||||.:|
Human   468 QVLNRLTFASTLSHLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYI 532

  Fly   510 TTEVEERPVMIVAFNAGVEDIREVSGNPINNPNVFLVFINGNVLGLTLNHKHLVRNLRYMRRK-G 573
            :...:..|::.......:|::.|:|  |....:...:|:||..:|:..:.:.|:..||.:||: .
Human   533 SVGSQPSPILEFLEEWSMENLEEIS--PAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMD 595

  Fly   574 RMGSYVSVHTSYTQRCIYIHTDGGRLCRPYVIVENRRPLVKQHHLDELNRGIRKFD-----DFLL 633
            .:.|.||:.....:|.|.|:||.||:|||.:|||.::.|:|:.|:|:|..  |:::     |.:.
Human   596 IIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKE--REYNNYSWQDLVA 658

  Fly   634 DGLIEYLDVNEENDSFIAWNEDQIEDRT-------THLEIEPFTLLGVCAGLVPYPHHNQSPRNT 691
            .|::||:|..||....:|...|.::::.       ||.||.|..:|||||.::|:|.||||||||
Human   659 SGVVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSPRNT 723

  Fly   692 YQCAMGKQAMGMIGYNQKNRIDSLMYNLVYPHAPMVKSKTIELTNFDKLPAGQNATVAVMSYSGY 756
            ||.||||||||:...|...|:|:|.:.|.||..|:|.::::|...|.:||||.|:.||:.||:||
Human   724 YQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGY 788

  Fly   757 DIEDALILNKASIDRGYGRCLVYKNSKCTVKRYANQTFDR---IMGPMKDALTNKVIFKHDVLDT 818
            :.||::|:|::::|||:.|.:.|::.|   ::.:.:.||:   ...|.::.........:|.||.
Human   789 NQEDSVIMNRSAVDRGFFRSVFYRSYK---EQESKKGFDQEEVFEKPTRETCQGMRHAIYDKLDD 850

  Fly   819 DGIVAPGEQVQNKQIMINKEMPAVTSMNPLQGQSAQVPYTAVPIS--YKGPEPSYIERVMVSANA 881
            ||::|||.:|....::|.|.:....:.:.|:..:.:  ||....|  .:..|...:::|||:.|.
Human   851 DGLIAPGVRVSGDDVIIGKTVTLPENEDELESTNRR--YTKRDCSTFLRTSETGIVDQVMVTLNQ 913

  Fly   882 EEDFLIKILLRQTRIPEIGDKFSSRHGQKGVTGLIVEQEDMPFNDFGICPDMIMNPHGFPSRMTV 946
            |.....||.:|..|||:|||||:|||||||..|:...||||||...||.||:|:|||..|||||:
Human   914 EGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEGITPDIIINPHAIPSRMTI 978

  Fly   947 GKTLELLGGKAGLLEGKFHYGTAFGGS-KVEDIQAELERHGFNYVGKDFFYSGITGTPLEAYIYS 1010
            |..:|.|.||....:|:....|.|..: .|:.|...|..:|::..|.:..|:|.||..:.:.|:.
Human   979 GHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQIFI 1043

  Fly  1011 GPVYYQKLKHMVQDKMHARARGPKAVLTRQPTQGRSREGGLRLGEMERDCLISYGASMLIMERLM 1075
            ||.|||:|||||.||:|:|||||..:|.|||.:||||:||||.|||||||.|::||:..:.|||.
Human  1044 GPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLF 1108

  Fly  1076 ISSDAFEVDVCRTCGRMAYCSW------CHFCQSSANVSKISMPYACKLLFQELTSMNVVPKMI 1133
            .:||.::|.||..||.||..:.      |..|::...:|.:.||||||||||||.||::.|:|:
Human  1109 EASDPYQVHVCNLCGIMAIANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPRMM 1172

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpIII128NP_523706.1 PRK08565 34..1135 CDD:236291 436/1170 (37%)
RNA_pol_B_RPB2 47..1133 CDD:238353 433/1156 (37%)
RNA_pol_Rpb2_2 210..370 CDD:282427 51/181 (28%)
RNA_pol_Rpb2_4 546..607 CDD:282431 24/62 (39%)
RNA_pol_Rpb2_5 628..668 CDD:282432 13/52 (25%)
POLR2BNP_000929.1 PRK08565 27..1172 CDD:236291 436/1168 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0085
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D42570at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126694
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.