DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpIII128 and Polr3b

Sequence 1:NP_523706.1 Gene:RpIII128 FlyBaseID:FBgn0004463 Length:1137 Species:Drosophila melanogaster
Sequence 2:NP_001178807.1 Gene:Polr3b RGDID:1565311 Length:1133 Species:Rattus norvegicus

Alignment Length:1120 Identity:772/1121 (69%)
Similarity:932/1121 (83%) Gaps:6/1121 (1%)


  Fly    22 KDWSVPIKPLTEKWKLVPAFLQVKGLVKQHIDSFNHFINVDIKKIVKANELVTSGADPLFYLKYL 86
            ::.:.||..:.|||:|:||||:|||||||||||||:||||:||||:||||.|||.|||::|||||
  Rat    14 EELAAPIPTVEEKWRLLPAFLKVKGLVKQHIDSFNYFINVEIKKIMKANEKVTSDADPMWYLKYL 78

  Fly    87 DVRVGKPDIDDGFNITKATTPHECRLRDTTYSAPITVDIEYTRGTQRIKRNNLLIGRMPLMLRCS 151
            ::.||.||:::.||:|:..:||||||||.|||||||||||||||:|||.||.|.|||||:|||.|
  Rat    79 NIYVGLPDVEESFNVTRPVSPHECRLRDMTYSAPITVDIEYTRGSQRIIRNALPIGRMPIMLRSS 143

  Fly   152 NCALTGKSEFELSKLNECPLDPGGYFVVRGQEKVILIQEQLSWNKMLTE-DFNGVVQCQVTSSTH 215
            ||.||||:..|.:|||||||||||||:|:|.|||||||||||.|:::.| |..|.|...||||||
  Rat   144 NCVLTGKTPAEFAKLNECPLDPGGYFIVKGVEKVILIQEQLSKNRIIVEADRKGAVGASVTSSTH 208

  Fly   216 EKKSRTLVLSKHGKYYLKHNSMTDDIPIVVIFKALGVVSDQEIQSLIGIDSKSQNRFGASLIDAY 280
            ||||||.:..|.|::||:||::::|||||:||||:||.|||||..:||.:......||.||.:..
  Rat   209 EKKSRTNMAVKQGRFYLRHNTLSEDIPIVIIFKAMGVESDQEIVQMIGTEEHVMAAFGPSLEECQ 273

  Fly   281 NLKVFTQQRALEYMGSKLVVKR-FQSATTKTPSEEARELLLTTILAHVPVDNFNLQMKAIYVSMM 344
            ..::|||.:||:|:|:|:..:| :.....||..|||||||.:|||.||||..||.:.|.||.::|
  Rat   274 KAQIFTQMQALKYIGNKVRRQRMWGGGPKKTKIEEARELLASTILTHVPVKEFNFRAKCIYTAVM 338

  Fly   345 VRRVMAAELDKTLFDDRDYYGNKRLELAGSLLSMMFEDLFKRMNWELKTIADKNIPKVKAAQFDV 409
            ||||:.|:.|..: |||||||||||||||.|||::||||||:.|.|:|.|||:.|||.:||||||
  Rat   339 VRRVILAQGDNKV-DDRDYYGNKRLELAGQLLSLLFEDLFKKFNSEMKKIADQVIPKQRAAQFDV 402

  Fly   410 VKHMRAAQITAGLESAISSGNWTIKRFKMERAGVTQVLSRLSYISALGMMTRVNSQFEKTRKVSG 474
            |||||..|||.|:.:|||:|||::|||||:|.||||||||||||||||||||::|||||||||||
  Rat   403 VKHMRQDQITNGMVNAISTGNWSLKRFKMDRQGVTQVLSRLSYISALGMMTRISSQFEKTRKVSG 467

  Fly   475 PRSLQPSQWGMLCPSDTPEGEACGLVKNLALMTHITTEVEERPVMIVAFNAGVEDIREVSGNPIN 539
            |||||||||||||||||||||||||||||||||||||::|:.|::.:|.|.||||:..:.|..::
  Rat   468 PRSLQPSQWGMLCPSDTPEGEACGLVKNLALMTHITTDMEDGPIIKLAGNLGVEDVNLLCGEELS 532

  Fly   540 NPNVFLVFINGNVLGLTLNHKHLVRNLRYMRRKGRMGSYVSVHTSYTQRCIYIHTDGGRLCRPYV 604
            .|||||||:|||:||:..:||.||...|.|||.|.:..:||:.|:.|.||:||.:|||||||||:
  Rat   533 YPNVFLVFLNGNILGVIRDHKKLVSTFRLMRRAGYINEFVSISTNLTDRCVYISSDGGRLCRPYI 597

  Fly   605 IVENRRPLVKQHHLDELNRGIRKFDDFLLDGLIEYLDVNEENDSFIAWNEDQIEDRTTHLEIEPF 669
            ||:.::|.|...|::||.:|.|.|:|||.:.|:||||||||||..||..|..|...|||||||||
  Rat   598 IVKKQKPAVTNKHMEELAQGYRNFEDFLHESLVEYLDVNEENDCNIALYEHTINKDTTHLEIEPF 662

  Fly   670 TLLGVCAGLVPYPHHNQSPRNTYQCAMGKQAMGMIGYNQKNRIDSLMYNLVYPHAPMVKSKTIEL 734
            |||||||||:|||||||||||||||||||||||.|||||:||||:|||.|.||..||||:|||||
  Rat   663 TLLGVCAGLIPYPHHNQSPRNTYQCAMGKQAMGTIGYNQRNRIDTLMYLLAYPQKPMVKTKTIEL 727

  Fly   735 TNFDKLPAGQNATVAVMSYSGYDIEDALILNKASIDRGYGRCLVYKNSKCTVKRYANQTFDRIMG 799
            .:|:||||||||||||||||||||||||:|||||:|||:||||||||:|||:|||.|||||::||
  Rat   728 IDFEKLPAGQNATVAVMSYSGYDIEDALVLNKASLDRGFGRCLVYKNAKCTLKRYTNQTFDKVMG 792

  Fly   800 PMKDALTNKVIFKHDVLDTDGIVAPGEQVQNKQIMINKEMPAVTSMNPLQGQSA--QVPYTAVPI 862
            ||.||.|.|.|::|::||.|||.:|||:|:|||:::||.||.||.: ||:|.:.  |..|..|||
  Rat   793 PMLDAATRKPIWRHEILDADGICSPGEKVENKQVLVNKSMPTVTQI-PLEGSNVPQQPQYKDVPI 856

  Fly   863 SYKGPEPSYIERVMVSANAEEDFLIKILLRQTRIPEIGDKFSSRHGQKGVTGLIVEQEDMPFNDF 927
            :|||...||||:||:|:|||:.||||:||||||.||||||||||||||||.||||.||||||.|.
  Rat   857 TYKGATDSYIEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVCGLIVPQEDMPFCDS 921

  Fly   928 GICPDMIMNPHGFPSRMTVGKTLELLGGKAGLLEGKFHYGTAFGGSKVEDIQAELERHGFNYVGK 992
            |||||:|||||||||||||||.:|||.||||:|:|:||||||||||||:|:..:|.|||:||:||
  Rat   922 GICPDIIMNPHGFPSRMTVGKLIELLAGKAGVLDGRFHYGTAFGGSKVKDVCEDLVRHGYNYLGK 986

  Fly   993 DFFYSGITGTPLEAYIYSGPVYYQKLKHMVQDKMHARARGPKAVLTRQPTQGRSREGGLRLGEME 1057
            |:..|||||.|||||||.||||||||||||.||||||||||:||||||||:||||:|||||||||
  Rat   987 DYVTSGITGEPLEAYIYFGPVYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEME 1051

  Fly  1058 RDCLISYGASMLIMERLMISSDAFEVDVCRTCGRMAYCSWCHFCQSSANVSKISMPYACKLLFQE 1122
            |||||.||||||::|||||||||||||||..||.:.|..|||:|:||.:||.:.:||||||||||
  Rat  1052 RDCLIGYGASMLLLERLMISSDAFEVDVCGQCGLLGYSGWCHYCKSSCHVSSLRIPYACKLLFQE 1116

  Fly  1123 LTSMNVVPKMILENY 1137
            |.|||::|::.|..|
  Rat  1117 LQSMNIIPRLKLAKY 1131

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpIII128NP_523706.1 PRK08565 34..1135 CDD:236291 768/1105 (70%)
RNA_pol_B_RPB2 47..1133 CDD:238353 757/1090 (69%)
RNA_pol_Rpb2_2 210..370 CDD:282427 88/161 (55%)
RNA_pol_Rpb2_4 546..607 CDD:282431 35/61 (57%)
RNA_pol_Rpb2_5 628..668 CDD:282432 26/40 (65%)
Polr3bNP_001178807.1 PRK08565 26..1129 CDD:236291 768/1105 (70%)
RNA_pol_B_RPB2 39..1127 CDD:238353 757/1090 (69%)
RNA_pol_Rpb2_4 539..600 CDD:282431 35/61 (57%)
RNA_pol_Rpb2_5 621..661 CDD:282432 26/40 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55635584
eggNOG 1 0.900 E1_COG0085
Hieranoid 1 1.000
Homologene 1 1.000 H6981
Inparanoid 1 1.050 1589 1.000 Inparanoid score I78
OMA 1 1.010
OrthoDB 1 1.010 D42570at2759
OrthoFinder 1 1.000 FOG0003638
OrthoInspector 1 1.000 T1086276
orthoMCL 1 0.900 OOG5_126694
Panther 1 1.100 LDO PTHR20856
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.