DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpIII128 and rpc-2

Sequence 1:NP_523706.1 Gene:RpIII128 FlyBaseID:FBgn0004463 Length:1137 Species:Drosophila melanogaster
Sequence 2:NP_498192.2 Gene:rpc-2 WormBaseID:WBGene00017300 Length:1154 Species:Caenorhabditis elegans

Alignment Length:1129 Identity:687/1130 (61%)
Similarity:860/1130 (76%) Gaps:21/1130 (2%)


  Fly    30 PLTEKWKLVPAFLQVKGLVKQHIDSFNHFINVDIKKIVKANELVTSGADPLFYLKYLDVRVGKPD 94
            ||.:||.||||||:|:||||||:.||:||:..:|:.|:.:|:.:||.|:|.|||||||:|:|||.
 Worm    24 PLEDKWLLVPAFLKVRGLVKQHLVSFDHFVQEEIRSIMLSNQKITSDANPNFYLKYLDIRIGKPS 88

  Fly    95 IDDGFNIT-KATTPHECRLRDTTYSAPITVDIEYTRGTQRIKRNNLLIGRMPLMLRCSNCALTGK 158
            .::|.|:| ...||.||||||.||||||:||||||||.||:.:.:|:|||||:|||.|.|.|...
 Worm    89 SEEGLNMTHDKITPQECRLRDMTYSAPISVDIEYTRGNQRVFKKDLIIGRMPIMLRSSKCILRDL 153

  Fly   159 SEFELSKLNECPLDPGGYFVVRGQEKVILIQEQLSWNK-MLTEDFNGVVQCQVTSSTHEKKSRTL 222
            :|.||:::.|||.||||||||:|.|||||||||||.|: |:..:.:..:||:|.|||.|:||:|.
 Worm   154 AEEELARVQECPYDPGGYFVVKGSEKVILIQEQLSKNRIMVGRNSSKELQCEVLSSTSERKSKTY 218

  Fly   223 VLSKHGKYYLKHNSMTDDIPIVVIFKALGVVSDQEIQSLIGIDSKSQNRFGASLIDAYNLKVFTQ 287
            |..|.|||.::||.:|||:|:.:||||:||.||.:|.|.||.:.|..:.|..:|.::.|..|:||
 Worm   219 VTMKKGKYSVRHNQLTDDVPVSIIFKAMGVESDFDIVSTIGHEEKYVSAFAQTLEESINAGVYTQ 283

  Fly   288 QRALEYMGSKLVVKRF--------QSATTKTP--SEEARELLLTTILAHVPVDNFNLQMKAIYVS 342
            |:||.|:.||:..::|        .|.:..||  ..||.:.|..:::.|:...:.|.:|||||:.
 Worm   284 QQALAYVTSKVKARKFTPFGSLPGTSVSVLTPPKEHEAVDFLSNSMITHIACPDGNFKMKAIYLG 348

  Fly   343 MMVRRVMAAELDKTLFDDRDYYGNKRLELAGSLLSMMFEDLFKRMNWELKTIADKNIPKVKAAQF 407
            :|.||::..||.:...||||:||||||||||||||::|||:|||.|.|||.|||..:.|..||..
 Worm   349 LMTRRLIQTELGENGLDDRDFYGNKRLELAGSLLSLLFEDVFKRFNSELKRIADNALMKTMAAPL 413

  Fly   408 DVVKHMRAAQITAGLESAISSGNWTIKRFKMERAGVTQVLSRLSYISALGMMTRVNSQFEKTRKV 472
            |:|||||...||..:.:|:|:|||.||||:|||.||||||||||||||||||||:||.|||||||
 Worm   414 DIVKHMRQDMITNTIVNAMSTGNWIIKRFRMERLGVTQVLSRLSYISALGMMTRINSTFEKTRKV 478

  Fly   473 SGPRSLQPSQWGMLCPSDTPEGEACGLVKNLALMTHITTEVEERPVMIVAFNAGVEDIREVSGNP 537
            |||||||||||||||||||||||||||||||||::||||:.:|:||:.:..|:||||:..|..:.
 Worm   479 SGPRSLQPSQWGMLCPSDTPEGEACGLVKNLALISHITTDSDEKPVLRLLLNSGVEDLHNVHFSH 543

  Fly   538 INNPNVFLVFINGNVLGLTLNHKHLVRNLRYMRRKGRMGSYVSVHTSYTQRCIYIHTDGGRLCRP 602
            :|.|...|:|:||.::|..::.:.:|:.:|.:||.|.:..:|||..|.|.|.::|.:||||||||
 Worm   544 VNKPENTLIFLNGVLIGTAVDPERVVKAVRDLRRSGLLSEFVSVSRSLTNRSVFISSDGGRLCRP 608

  Fly   603 YVIVENRRPLVKQHHLDELNRGIRKFDDFLLDGLIEYLDVNEENDSFIAWNEDQIEDRTTHLEIE 667
            |:||:|..|::.|.|:.||..|...|:||:.||::|||||||.||:.||....:|...|||||||
 Worm   609 YIIVKNGTPMLTQAHVQELKEGKMIFEDFVDDGIVEYLDVNEMNDALIAVYGREIGPETTHLEIE 673

  Fly   668 PFTLLGVCAGLVPYPHHNQSPRNTYQCAMGKQAMGMIGYNQKNRIDSLMYNLVYPHAPMVKSKTI 732
            |||||||||||:|||||||||||||||||||||||.|.|||:.||||:||.|.||..|:||||||
 Worm   674 PFTLLGVCAGLIPYPHHNQSPRNTYQCAMGKQAMGTIAYNQQKRIDSIMYLLCYPQRPLVKSKTI 738

  Fly   733 ELTNFDKLPAGQNATVAVMSYSGYDIEDALILNKASIDRGYGRCLVYKNSKCTVKRYANQTFDRI 797
            |||||:|||||.|..:||||||||||||||:|||||:|||||||||||:.|.|.|:|.||||||:
 Worm   739 ELTNFEKLPAGANGIIAVMSYSGYDIEDALVLNKASLDRGYGRCLVYKHVKGTAKKYPNQTFDRL 803

  Fly   798 MGPMKDALTNKVIFKHDVLDTDGIVAPGEQVQNKQIMINKEMPAVT---------SMNPLQGQSA 853
            :||..|..|.|.||||..||.:|||..|.::..||.:|||.||.|:         |.|.:.....
 Worm   804 LGPALDPNTRKPIFKHKNLDQEGIVFAGARIMPKQTIINKHMPVVSGESGPGASASANTIGIAGR 868

  Fly   854 QVPYTAVPISYKGPEPSYIERVMVSANAEEDFLIKILLRQTRIPEIGDKFSSRHGQKGVTGLIVE 918
            ||.|..|.|:||.|.|||.|||:::.|.:|..|.|:||||||.||:|||||||||||||.|||.:
 Worm   869 QVDYKDVSITYKTPTPSYAERVLLTYNEDEAHLFKVLLRQTRRPELGDKFSSRHGQKGVCGLIAQ 933

  Fly   919 QEDMPFNDFGICPDMIMNPHGFPSRMTVGKTLELLGGKAGLLEGKFHYGTAFGGSKVEDIQAELE 983
            ||||||||.|:.|||||||||:||||||||.:|||.||||::.|.:||||||||.:|:|:..||.
 Worm   934 QEDMPFNDLGMVPDMIMNPHGYPSRMTVGKLMELLSGKAGVVNGTYHYGTAFGGDQVKDVCEELA 998

  Fly   984 RHGFNYVGKDFFYSGITGTPLEAYIYSGPVYYQKLKHMVQDKMHARARGPKAVLTRQPTQGRSRE 1048
            ..|:||:|||...|||||.||.||||.||:|||||||||.||||||||||:|.||||||:|||||
 Worm   999 ACGYNYMGKDMLTSGITGQPLSAYIYFGPIYYQKLKHMVLDKMHARARGPRAALTRQPTEGRSRE 1063

  Fly  1049 GGLRLGEMERDCLISYGASMLIMERLMISSDAFEVDVCRTCGRMAYCSWCHFCQSSANVSKISMP 1113
            ||||||||||||||:||||||::||||:|||.|:||||..||.:....||..|:||.:::.|.:|
 Worm  1064 GGLRLGEMERDCLIAYGASMLLIERLMVSSDEFKVDVCTGCGVIGSKGWCQKCRSSKSMANIKIP 1128

  Fly  1114 YACKLLFQELTSMNVVPKMILENY 1137
            ||||||||||.|||:||::.|..|
 Worm  1129 YACKLLFQELQSMNIVPRLDLARY 1152

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpIII128NP_523706.1 PRK08565 34..1135 CDD:236291 684/1122 (61%)
RNA_pol_B_RPB2 47..1133 CDD:238353 673/1107 (61%)
RNA_pol_Rpb2_2 210..370 CDD:282427 73/170 (43%)
RNA_pol_Rpb2_4 546..607 CDD:282431 27/61 (44%)
RNA_pol_Rpb2_5 628..668 CDD:282432 24/40 (60%)
rpc-2NP_498192.2 PRK08565 28..1150 CDD:236291 684/1122 (61%)
RNA_pol_B_RPB2 41..1148 CDD:238353 673/1107 (61%)
RNA_pol_Rpb2_4 552..613 CDD:282431 27/61 (44%)
RNA_pol_Rpb2_5 634..674 CDD:282432 24/40 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55014273
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H6981
Inparanoid 1 1.050 1386 1.000 Inparanoid score I57
Isobase 1 0.950 0 Normalized mean entropy S207
OMA 1 1.010
OrthoDB 1 1.010 D42570at2759
OrthoFinder 1 1.000 FOG0003638
OrthoInspector 1 1.000 T477353
orthoMCL 1 0.900 OOG5_126694
Panther 1 1.100 LDO PTHR20856
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1190
TreeFam 00.000 Not matched by this tool.
1312.890

Return to query results.
Submit another query.