DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpIII128 and rpb-2

Sequence 1:NP_523706.1 Gene:RpIII128 FlyBaseID:FBgn0004463 Length:1137 Species:Drosophila melanogaster
Sequence 2:NP_498047.2 Gene:rpb-2 WormBaseID:WBGene00016140 Length:1194 Species:Caenorhabditis elegans

Alignment Length:1162 Identity:430/1163 (37%)
Similarity:670/1163 (58%) Gaps:76/1163 (7%)


  Fly    35 WKLVPAFLQVKGLVKQHIDSFNHFINVDIKKIVKAN----------ELVTSGADPL-FYLKYLDV 88
            |.::.|:...||||:|.:|||:.|:.:::::||:.:          .|.|...:|. |.||:..:
 Worm    35 WVVISAYFDEKGLVRQQLDSFDEFVQMNVQRIVEDSPPVELQSENQHLGTDMENPAKFSLKFNQI 99

  Fly    89 RVGKPDIDDGFNITKATTPHECRLRDTTYSAPITVDIE--YTR---GTQRIKRNNLLIGRMPLML 148
            .:.||...:.........|:|.|||:.||::|:.|||.  .||   .|::: .:.:.:|::|:||
 Worm   100 YLSKPTHWEKDGAPMPMMPNEARLRNLTYASPLYVDITKVVTRDDSATEKV-YDKVFVGKVPVML 163

  Fly   149 RCSNCALTGKSEFELSKLNECPLDPGGYFVVRGQEKVILIQEQLSWN-----KMLTEDFNGVVQC 208
            |.|.|.|:..::.:|::|||||||||||||:.|.|||::.||:::.|     .|....:....:|
 Worm   164 RSSYCMLSNMTDRDLTELNECPLDPGGYFVINGSEKVLIAQEKMATNTVYVFSMKDGKYAFKTEC 228

  Fly   209 QVTSSTHEKKSRTL---VLSKHG---------------KYYLKHNSMTDDIPIVVIFKALGVVSD 255
            :.......:.:.|:   :|::.|               ..|:|     .:|||:::|:|||.|||
 Worm   229 RSCLENSSRPTSTMWVNMLARGGGGGKKTAMGQRIIGILPYIK-----QEIPIMIVFRALGFVSD 288

  Fly   256 QEIQSLIGI---DSKSQNRFGASLIDAYNLKVFTQQRALEYMGSKLVVKRFQSATTKTPSEEARE 317
            ::|...|..   |.:.......||.:|:.::  .|..||.::|::   ......|.:...:.|||
 Worm   289 RDILGHIIYDFNDPEMMEMVKPSLDEAFVIQ--EQNVALNFIGAR---GAKPGVTREQRIKYARE 348

  Fly   318 LLLTTILAHVPVDNFNLQMKAIYVSMMVRRVMAAELDKTLFDDRDYYGNKRLELAGSLLSMMFED 382
            :|...:|.||.|.......||.::..||.|::.|.|.:...||||:.|||||:|||.||:.:|..
 Worm   349 ILQKELLPHVGVSEHCETKKAFFIGYMVHRLLLAALGRRELDDRDHIGNKRLDLAGPLLAFLFRS 413

  Fly   383 LFKRMNWELKTIADKNIPKVKAAQFDVVKHMRAAQITAGLESAISSGNW-TIKRFKMERAGVTQV 446
            ||:.:..|::..|.|.|.|......||.  ::.:.||.||..::::||| ..|:....||||:||
 Worm   414 LFRNLLKEMRMTAQKYINKNDDFALDVC--VKTSTITRGLTYSLATGNWGDQKKAHQSRAGVSQV 476

  Fly   447 LSRLSYISALGMMTRVNSQFEKTRKVSGPRSLQPSQWGMLCPSDTPEGEACGLVKNLALMTHITT 511
            |:||:|.:.|..:.|.||...:..|::.||.|..:||||:||::||||:|.|||||||||.:|:.
 Worm   477 LNRLTYTATLSHLRRANSPIGREGKLAKPRQLHNTQWGMVCPAETPEGQAVGLVKNLALMAYISV 541

  Fly   512 EVEERPVMIVAFNAGVEDIREVSGNPINNPNVFLVFINGNVLGLTLNHKHLVRNLRYMRRK-GRM 575
            .....|::.......:|::.|||.:.|  .:...:|:||..:|:......|:..|:.:||: ..:
 Worm   542 GSLPEPILEFLEEWSMENLEEVSPSAI--ADATKIFVNGAWVGIHREPDQLMTTLKKLRRQMDII 604

  Fly   576 GSYVSVHTSYTQRCIYIHTDGGRLCRPYVIVENRRPLVKQHHLDELNRGIRK-----FDDFLLDG 635
            .|.||:......|.|.|:||.||:|||.:||||::..:|:.|:|:|.....:     :.|.:..|
 Worm   605 VSEVSMVRDIRDREIRIYTDAGRVCRPLLIVENQKLALKKRHIDQLKEAADEANKYTWSDLVGGG 669

  Fly   636 LIEYLDVNEENDSFIAWNEDQIE-----DRTTHLEIEPFTLLGVCAGLVPYPHHNQSPRNTYQCA 695
            ::|.:|..||..|.||...:.:.     |..||.||.|..:|||||.::|:|.||||||||||.|
 Worm   670 VVELIDSMEEETSMIAMMPEDLRSGGYCDTHTHCEIHPAMILGVCASIIPFPDHNQSPRNTYQSA 734

  Fly   696 MGKQAMGMIGYNQKNRIDSLMYNLVYPHAPMVKSKTIELTNFDKLPAGQNATVAVMSYSGYDIED 760
            |||||||:...|...|:|:|.:.|.||..|:|.::::|...|::||||.||.||::|||||:.||
 Worm   735 MGKQAMGVYTTNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFNELPAGINAIVAILSYSGYNQED 799

  Fly   761 ALILNKASIDRGYGRCLVYKNSKCTVKRYANQTFDRIMGPMKDALTNKVIFKHDVLDTDGIVAPG 825
            ::|:|.::||||..|.:.|::.:.......|...:.|..|.::..:......:|.||.|||::||
 Worm   800 SVIMNNSAIDRGLFRSVFYRSYRDNEANLDNANEELIEKPTREKCSGMRHSLYDKLDEDGIISPG 864

  Fly   826 EQVQNKQIMINKEMPAVTSMNPLQGQSAQVPYTAVPISYKGPEPSYIERVMVSANAEEDFLIKIL 890
            .:|....::|.|.:......:.|.....:.|........:..|...:::||:|.|::.:..:||.
 Worm   865 MRVSGDDVIIGKTVALPDIDDDLDASGKKYPKRDASTFLRSSETGIVDQVMLSLNSDGNKFVKIR 929

  Fly   891 LRQTRIPEIGDKFSSRHGQKGVTGLIVEQEDMPFNDFGICPDMIMNPHGFPSRMTVGKTLELLGG 955
            :|..|:|:|||||:|||||||..|::..||||||...|:.||:|:|||..|||||:|..:|.|.|
 Worm   930 MRSVRLPQIGDKFASRHGQKGTMGIMYRQEDMPFTAEGLTPDIIINPHAVPSRMTIGHLIECLQG 994

  Fly   956 KAGLLEGKFHYGTAFGGS-KVEDIQAELERHGFNYVGKDFFYSGITGTPLEAYIYSGPVYYQKLK 1019
            |....:|:....|.|..: .|:.|...|..:|::..|.:..|:|.||..|...|:.||.|||:||
 Worm   995 KLSANKGEIGDATPFNDTVNVQKISGLLCEYGYHLRGNEVMYNGHTGKKLTTQIFFGPTYYQRLK 1059

  Fly  1020 HMVQDKMHARARGPKAVLTRQPTQGRSREGGLRLGEMERDCLISYGASMLIMERLMISSDAFEVD 1084
            |||.||:|:|||||..::.|||.:||:|:||||.|||||||.||:||:..:.|||...||.:.|.
 Worm  1060 HMVDDKIHSRARGPIQMMNRQPMEGRARDGGLRFGEMERDCQISHGATQFLRERLFEVSDPYHVY 1124

  Fly  1085 VCRTCGRMAYCSW------CHFCQSSANVSKISMPYACKLLFQELTSMNVVPKMILE 1135
            ||..||.:...:.      |..|::...||.:.:|||||||||||.||::.|:::::
 Worm  1125 VCNNCGLIVVANLRTNSFECKACRNKTQVSAVRIPYACKLLFQELMSMSIAPRLMVK 1181

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpIII128NP_523706.1 PRK08565 34..1135 CDD:236291 430/1161 (37%)
RNA_pol_B_RPB2 47..1133 CDD:238353 426/1147 (37%)
RNA_pol_Rpb2_2 210..370 CDD:282427 50/181 (28%)
RNA_pol_Rpb2_4 546..607 CDD:282431 23/62 (37%)
RNA_pol_Rpb2_5 628..668 CDD:282432 14/45 (31%)
rpb-2NP_498047.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0085
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D42570at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126694
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.