DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpIII128 and polr1b

Sequence 1:NP_523706.1 Gene:RpIII128 FlyBaseID:FBgn0004463 Length:1137 Species:Drosophila melanogaster
Sequence 2:XP_002940442.1 Gene:polr1b XenbaseID:XB-GENE-1008539 Length:1135 Species:Xenopus tropicalis

Alignment Length:1216 Identity:349/1217 (29%)
Similarity:545/1217 (45%) Gaps:211/1217 (17%)


  Fly    18 PGDSKDWSVPIKPLTEKWKLVPAFLQVKGLVKQHIDSFNHFINVDIKKIVKANELVTSGADPLFY 82
            ||:|:  ..|::.:|                :.||||||..:...:...|:|.:       ||.:
 Frog    27 PGESQ--HPPLQDIT----------------RAHIDSFNQAMTEGLSLAVQAMK-------PLEF 66

  Fly    83 --------LKYLDVRVGKPDIDDGFNITKATT--PHECRLRDTTYSAPITVDIEYT-RGTQR--I 134
                    |:.:|..:..|.:..| :|.|...  |.|||.|.:||...:|.|:.:: .|.|:  |
 Frog    67 TYKNDKVALQIVDAVITPPLVPKG-SICKEQKIYPAECRGRRSTYRGKLTADVSWSLNGLQKGII 130

  Fly   135 KRNNLLIGRMPLMLRCSNCALTGKSEFELSKLNECPLDPGGYFVVRGQEKVI--LIQEQLSWN-K 196
            |:.   :|.:|:|::...|.|...:..:|.:.:|...:.||||::.|.||||  ||..:.::. .
 Frog   131 KQT---LGHIPIMVKSKFCNLYDLNPKQLLEHHEEEQEMGGYFIINGIEKVIRMLIMPRRNFPIA 192

  Fly   197 MLTEDFN----GVVQCQVTSSTHEKKSRTLVLSKHGKYYLKHNSMTDD---------IPIVVIFK 248
            |:...:.    |..|..::......:...:.::.|   ||::.|:..:         ||:....|
 Frog   193 MIRPKWKNRGPGYTQYGISLRCVRDEHTAVNMNLH---YLENGSVMVNFIYQKELFFIPLGFALK 254

  Fly   249 ALGVVSDQEIQSLIGIDSKSQNRFGASLIDAYNLKV-----FTQQRALEYMGSKLVVKRFQSATT 308
            ||...||.:|.:.: |..|.:|.|....:......|     .:|:..|:|:|.:..|| |.....
 Frog   255 ALVDYSDYQIFTEL-IKGKEENSFYRDCMTQMLRAVVEEGCHSQKNVLKYLGERFRVK-FYLPDW 317

  Fly   309 KTPSEEARELLLTTILAHVPVDNFNLQMKAIYVSMMVRRVMAAELDKTLFDDRDYYGNKRLELAG 373
            .|..:.|..|:...|..|:..   |:: |...:.||.:::.....|..:.::.|....:.:...|
 Frog   318 FTDEQAAEFLISQCICIHLKT---NVE-KFYMLCMMTQKLFTFAKDGCMEENPDSLMYQEVMTPG 378

  Fly   374 SLLSMMFEDLFKRMNWEL--KTIADK------------NIPKVKAAQFDVVKHMRAAQITAGLES 424
            .||.|..::  |..:|.|  |...||            .:.||..:..|:.|.......|..|.|
 Frog   379 QLLLMFLKE--KMESWLLGVKVNLDKRAHKYTVDLSTETMMKVFTSTSDLTKTCEYLLATGNLRS 441

  Fly   425 AISSGNWTIKRFKMERAGVTQVLSRLSYISALGMMTRVN--SQFEKTRKVSGPRSLQPSQWGMLC 487
            ....|       .::.:|:..|..:|::|..|.....|:  :.|.|.|..| .|.|.|..||.||
 Frog   442 KTGLG-------MLQSSGLVVVADKLNFIRYLSHFRCVHRGAAFAKMRTTS-VRRLLPESWGFLC 498

  Fly   488 PSDTPEGEACGLVKNLALMTHITTEVEERPVM-IVAFNAGVEDIREVSGNPINNPNVFLVFINGN 551
            |..||:||.|||:.::.....|.|:.....:: ::..:.|:..:...:|...  .:.:.|.::|.
 Frog   499 PVHTPDGEPCGLMNHMTAACEIVTQTSYNTLLPLLLCSLGMTPVDGTAGKLF--ADCYPVMLDGA 561

  Fly   552 VLG-----LTLNHKHLVRNLRYMRRK--------------GRMGSYVSVHTSYTQRCIYIHTDGG 597
            ::|     :.......:||.:....|              |:...|..         :::.|...
 Frog   562 MVGWVEKTIAPGLVSALRNYKVKHEKNVPPWTEIVLIPMTGKASLYPG---------LFLFTTPC 617

  Fly   598 RLCRPYVIVENRRPLVKQHHLDELNRGIRKFDDFLLDGLIEYLDVNEENDSFIAWNEDQIEDRTT 662
            |:.||   |.| ..|.|:..|                |.:|.:.:|     ...:..|.:...||
 Frog   618 RMVRP---VRN-LALGKEELL----------------GTLEQVFLN-----VAVYEGDIVPGETT 657

  Fly   663 HLEIEPFTLLGVCAGLVPYPHHNQSPRNTYQCAMGKQAMGMIGYNQKNRIDSLMYNLVYPHAPMV 727
            |.|..|.::|.|.|..:|:..|||||||.|||.||||.||......::|.|:.:|.|..|.:|:|
 Frog   658 HQEFFPHSMLSVVANFIPFSDHNQSPRNMYQCQMGKQTMGFPLMTYQDRSDNKLYRLQTPQSPLV 722

  Fly   728 KSKTIELTNFDKLPAGQNATVAVMSYSGYDIEDALILNKASIDRGYGRCLVYKNSKCTVKRYANQ 792
            :....:....|..|.|.||.|||:||:|||:|||::|||:|.:||:....|||.....:.:    
 Frog   723 RPSMYDYYEMDNYPIGTNAIVAVISYTGYDMEDAMVLNKSSWERGFAHGSVYKTDHVDLSK---- 783

  Fly   793 TFDRIMGPMKDALTNKVI-FKHD------VLDTDGIVAPGEQVQNKQIMINKEMPAVTSMNPLQG 850
                   .:||...|.|. .|.|      .||:||:.|.|..:|...       |....:|...|
 Frog   784 -------KLKDGEDNLVFGIKPDDERVKGRLDSDGLPAVGAVLQFGD-------PYYGYLNLNTG 834

  Fly   851 QSAQVPYTAVPISYKGPEPSYIERVMVSANAEEDF----LIKILLRQTRIPEIGDKFSSRHGQKG 911
            :|. |.|      ||..|...|:.:.:.:| :..|    .:.:.:|..|.|.|||||:|||||||
 Frog   835 ESF-VAY------YKSKENCVIDNIKICSN-DIGFGKFKSVCVTMRIPRNPTIGDKFASRHGQKG 891

  Fly   912 VTGLIVEQEDMPFNDFGICPDMIMNPHGFPSRMTVGKTLELLGGKAGLLEGKFHYGTAF----GG 972
            :...:...|||||.:.|:.||::.||||||||||:|..:|.:.||:..|.|..|..|.|    ..
 Frog   892 ILSRLWPSEDMPFTESGMVPDILFNPHGFPSRMTIGMLIESMAGKSAALHGLCHDATPFTFSEEN 956

  Fly   973 SKVEDIQAELERHGFNYVGKDFFYSGITGTPLEAYIYSGPVYYQKLKHMVQDKMHARARGPKAVL 1037
            |.:|.....|...|:|:.|.:..||||:|..|||.|:.|.||||:|:|||.||...|..|.:..:
 Frog   957 SALEYFGEMLRAGGYNFYGTEKLYSGISGLELEADIFIGVVYYQRLRHMVSDKFQVRTTGARDKV 1021

  Fly  1038 TRQPTQGRSREGGLRLGEMERDCLISYGASMLIMERLMISSDAFEVDVCRTCGRMAY-------C 1095
            |.||..||:.:||:|.||||||.|:::|.|.|:.:||...||.....||..||.:..       .
 Frog  1022 TNQPVGGRNVQGGIRFGEMERDALLAHGTSFLLHDRLFNCSDRSTAHVCIECGSLLSPFLEKPPP 1086

  Fly  1096 SW---------CHFCQSSANVSKISMPYACKLLFQELTSMNVVPKM 1132
            ||         |..|..:..|..:|:||..:....||.:||:..|:
 Frog  1087 SWSSIRNRKHHCEVCDRTDTVETVSVPYVFRYFVAELAAMNISVKL 1132

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpIII128NP_523706.1 PRK08565 34..1135 CDD:236291 344/1201 (29%)
RNA_pol_B_RPB2 47..1133 CDD:238353 344/1188 (29%)
RNA_pol_Rpb2_2 210..370 CDD:282427 35/174 (20%)
RNA_pol_Rpb2_4 546..607 CDD:282431 13/80 (16%)
RNA_pol_Rpb2_5 628..668 CDD:282432 8/40 (20%)
polr1bXP_002940442.1 RpoB 33..1132 CDD:223163 346/1207 (29%)
RNA_pol_B_RPB2 38..1132 CDD:238353 345/1202 (29%)
RNA_pol_Rpb2_2 186..374 CDD:282427 38/197 (19%)
RNA_pol_Rpa2_4 563..616 CDD:284335 7/62 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0085
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D42570at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.