DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpIII128 and polr3b

Sequence 1:NP_523706.1 Gene:RpIII128 FlyBaseID:FBgn0004463 Length:1137 Species:Drosophila melanogaster
Sequence 2:NP_001121521.1 Gene:polr3b XenbaseID:XB-GENE-5799940 Length:1134 Species:Xenopus tropicalis

Alignment Length:1116 Identity:765/1117 (68%)
Similarity:925/1117 (83%) Gaps:7/1117 (1%)


  Fly    27 PIKPLTEKWKLVPAFLQVKGLVKQHIDSFNHFINVDIKKIVKANELVTSGADPLFYLKYLDVRVG 91
            |:..:.|||||:||||:|||||||||||||:|||.:||||:||||.|||.|||::|||||::.||
 Frog    19 PVDTVQEKWKLLPAFLKVKGLVKQHIDSFNYFINDEIKKIMKANEKVTSDADPMWYLKYLNIYVG 83

  Fly    92 KPDIDDGFNITKATTPHECRLRDTTYSAPITVDIEYTRGTQRIKRNNLLIGRMPLMLRCSNCALT 156
            .||:::.||:|:..:||||||||.|||||||||||||||:|||.||.|.|||||:|||.|||.||
 Frog    84 LPDVEESFNVTRPVSPHECRLRDMTYSAPITVDIEYTRGSQRIIRNALPIGRMPIMLRSSNCVLT 148

  Fly   157 GKSEFELSKLNECPLDPGGYFVVRGQEKVILIQEQLSWNKMLTE-DFNGVVQCQVTSSTHEKKSR 220
            ||:..|.:|||||||||||||:|:|.|||||||||||.|:::.| |..|.|...|||||||||||
 Frog   149 GKTPAEFAKLNECPLDPGGYFIVKGVEKVILIQEQLSKNRIIVEADRKGTVGASVTSSTHEKKSR 213

  Fly   221 TLVLSKHGKYYLKHNSMTDDIPIVVIFKALGVVSDQEIQSLIGIDSKSQNRFGASLIDAYNLKVF 285
            |.::.|.|::|||||::|:||||.:||||:||.|||||..:||.:......|..||.:....::|
 Frog   214 TNLVVKQGRFYLKHNTLTEDIPIAIIFKAMGVESDQEIVQMIGTEEHVIAAFAPSLEECQKAQIF 278

  Fly   286 TQQRALEYMGSKLVVKRF--QSATTKTPSEEARELLLTTILAHVPVDNFNLQMKAIYVSMMVRRV 348
            ||.:||:::|:|:..:|.  .|...|:..:||||||.:|||.||||..|:.:.|.||:::|||||
 Frog   279 TQMQALKFIGNKVRRQRMWGSSGPKKSKIDEARELLASTILTHVPVKEFHFRTKCIYIAVMVRRV 343

  Fly   349 MAAELDKTLFDDRDYYGNKRLELAGSLLSMMFEDLFKRMNWELKTIADKNIPKVKAAQFDVVKHM 413
            :.|: .....|||||||||||||||.|||::||||||:.|.|:|.|||:.|||.:||||||||||
 Frog   344 ILAQ-GANKVDDRDYYGNKRLELAGQLLSLLFEDLFKKFNSEMKKIADQVIPKQRAAQFDVVKHM 407

  Fly   414 RAAQITAGLESAISSGNWTIKRFKMERAGVTQVLSRLSYISALGMMTRVNSQFEKTRKVSGPRSL 478
            |..|||.|:.:|||||||::|||||:|.||||||||||||:|||||||::|||||||||||||||
 Frog   408 RQDQITNGMVNAISSGNWSLKRFKMDRQGVTQVLSRLSYIAALGMMTRISSQFEKTRKVSGPRSL 472

  Fly   479 QPSQWGMLCPSDTPEGEACGLVKNLALMTHITTEVEERPVMIVAFNAGVEDIREVSGNPINNPNV 543
            |||||||||||||||||||||||||||||||||::|:.|::.:|.|.||||:..:.|..::..||
 Frog   473 QPSQWGMLCPSDTPEGEACGLVKNLALMTHITTDMEDGPIIKLAANLGVEDVNLLCGEELSYANV 537

  Fly   544 FLVFINGNVLGLTLNHKHLVRNLRYMRRKGRMGSYVSVHTSYTQRCIYIHTDGGRLCRPYVIVEN 608
            ||||:|||:||:..:|:.||...|.|||.|.:..:||:.|:.:.||:||.:|||||||||:||:|
 Frog   538 FLVFLNGNILGVIRDHQKLVNTFRLMRRAGYINEFVSISTNISDRCVYISSDGGRLCRPYIIVKN 602

  Fly   609 RRPLVKQHHLDELNRGIRKFDDFLLDGLIEYLDVNEENDSFIAWNEDQIEDRTTHLEIEPFTLLG 673
            :|..|...|:.||::|.|.|:|||.:.|:||||||||||..:|..|..|...|||||||||||||
 Frog   603 QRSAVTNKHIQELSQGYRSFEDFLHESLVEYLDVNEENDCNVALYEHTITKHTTHLEIEPFTLLG 667

  Fly   674 VCAGLVPYPHHNQSPRNTYQCAMGKQAMGMIGYNQKNRIDSLMYNLVYPHAPMVKSKTIELTNFD 738
            |||||:|||||||||||||||||||||||.|||||:||||:|||.|.||..||||:|||||..|:
 Frog   668 VCAGLIPYPHHNQSPRNTYQCAMGKQAMGTIGYNQRNRIDTLMYLLAYPQRPMVKTKTIELIEFE 732

  Fly   739 KLPAGQNATVAVMSYSGYDIEDALILNKASIDRGYGRCLVYKNSKCTVKRYANQTFDRIMGPMKD 803
            ||||||||||||||||||||||||:|||||:|||:||||||||:|||:|||:|||||::||||.|
 Frog   733 KLPAGQNATVAVMSYSGYDIEDALVLNKASLDRGFGRCLVYKNAKCTLKRYSNQTFDKVMGPMLD 797

  Fly   804 ALTNKVIFKHDVLDTDGIVAPGEQVQNKQIMINKEMPAVTSMNPLQGQSA--QVPYTAVPISYKG 866
            |.|.|.|::|::||.|||.:|||:|:|||:::||.||.|| ..||:|.|.  |..|..|||:|||
 Frog   798 ANTRKQIWRHEILDADGICSPGEKVENKQVLVNKYMPTVT-QTPLEGSSVPQQPQYKDVPITYKG 861

  Fly   867 PEPSYIERVMVSANAEEDFLIKILLRQTRIPEIGDKFSSRHGQKGVTGLIVEQEDMPFNDFGICP 931
            |..||||:||:|:|||:.|||||||||||.||||||||||||||||.||||.||||||.:.||||
 Frog   862 PTDSYIEKVMISSNAEDAFLIKILLRQTRRPEIGDKFSSRHGQKGVCGLIVPQEDMPFCETGICP 926

  Fly   932 DMIMNPHGFPSRMTVGKTLELLGGKAGLLEGKFHYGTAFGGSKVEDIQAELERHGFNYVGKDFFY 996
            |:||||||:||||||||.:|||.||||:|:|:||||||||||||:|:..:|.|:|:||:|||:..
 Frog   927 DIIMNPHGYPSRMTVGKLIELLAGKAGVLDGRFHYGTAFGGSKVKDVCEDLIRYGYNYLGKDYVT 991

  Fly   997 SGITGTPLEAYIYSGPVYYQKLKHMVQDKMHARARGPKAVLTRQPTQGRSREGGLRLGEMERDCL 1061
            |||||.|||||||.||||||||||||.||||||||||:||||||||:||||:|||||||||||||
 Frog   992 SGITGEPLEAYIYFGPVYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCL 1056

  Fly  1062 ISYGASMLIMERLMISSDAFEVDVCRTCGRMAYCSWCHFCQSSANVSKISMPYACKLLFQELTSM 1126
            |.||||||::|||||||||||||||..||.:.|..|||||:||.:||.:.:|||||||||||.||
 Frog  1057 IGYGASMLLLERLMISSDAFEVDVCGKCGLLGYSGWCHFCKSSCHVSSLRIPYACKLLFQELQSM 1121

  Fly  1127 NVVPKMILENY 1137
            |::|::.|..|
 Frog  1122 NIIPRLKLAKY 1132

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpIII128NP_523706.1 PRK08565 34..1135 CDD:236291 762/1106 (69%)
RNA_pol_B_RPB2 47..1133 CDD:238353 750/1091 (69%)
RNA_pol_Rpb2_2 210..370 CDD:282427 84/162 (52%)
RNA_pol_Rpb2_4 546..607 CDD:282431 33/61 (54%)
RNA_pol_Rpb2_5 628..668 CDD:282432 25/40 (63%)
polr3bNP_001121521.1 PRK08565 26..1130 CDD:236291 762/1106 (69%)
RNA_pol_B_RPB2 39..1128 CDD:238353 750/1091 (69%)
RNA_pol_Rpb2_4 540..601 CDD:282431 33/61 (54%)
RNA_pol_Rpb2_5 622..662 CDD:282432 25/40 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55630687
eggNOG 1 0.900 E1_COG0085
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H6981
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D42570at2759
OrthoFinder 1 1.000 FOG0003638
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.