DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mppe and TED1

Sequence 1:NP_001286327.1 Gene:Mppe FlyBaseID:FBgn0259985 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_012225.1 Gene:TED1 SGDID:S000001301 Length:473 Species:Saccharomyces cerevisiae

Alignment Length:472 Identity:89/473 (19%)
Similarity:142/473 (30%) Gaps:189/473 (40%)


  Fly    21 TLLLVFFNEFIVYYMA----QSSWQ------PIDCKL--------------------------DN 49
            |.|.:..|.:|..|.:    |.||.      |:...|                          |.
Yeast    14 TFLTIVANIYIYTYPSFHPEQCSWNCSNKNAPLQKDLTFVDKVKNYFSDVREQWHGSHASAGNDE 78

  Fly    50 CTRLLLIADPQILGNSYDRSSHSPLARYDSDRYLAKTFERALAFTQPHIIVFLGDL--------- 105
            ...:|...||||.|........|.|..|.:|.||...::......:|.::..:|||         
Yeast    79 DIHILAFGDPQIKGIWPKTPYVSRLDTYGNDYYLGHIYDMMQQRLKPQVVTVMGDLFSSQWIGDS 143

  Fly   106 -----------------------LDEGNIATAQEYK----QYVQRFRRIYQN------------- 130
                                   :.:.|:....:||    ::..||..|..|             
Yeast   144 EFHNRTKRYISRIFKRDPTSIENIKQQNLDEKGQYKANWPEWGDRFNEILDNVKENEADNQELSF 208

  Fly   131 ----KNYKKFRMISAFFQRVHVPGDNDIGGENGDYISNSNQRRFENEFMSEDLFDYDN------- 184
                :|...:......|..:::.|::|: |.:|| .:..:..||      .|||..||       
Yeast   209 GFGYENIHSWNPDLEDFLIINITGNHDV-GYSGD-ATYQHMTRF------HDLFGKDNYWIEYET 265

  Fly   185 ----RLRFFKINRMLLD--------------FSNPDRDNNADRLRIGVSHAPL-----LIGGGP- 225
                ..|...:|.:||:              |.|...:...:...:.::|.|.     |...|| 
Yeast   266 NTTHPWRIVVLNDLLLEGPALQPEFVEATWIFLNQLNERKFNGSTVLLTHVPFYKREGLCVDGPD 330

  Fly   226 ----------------LLRA---------------IISDLDPHIIFSGHWHESRIFIYPSTKVIN 259
                            |||:               |..:..|.||.:||.||....:| :.|..:
Yeast   331 TRYYPDAHAPESYKSGLLRSQNHLSESVSNQVLNMIFENGKPGIILTGHDHEGCETVY-NKKSTS 394

  Fly   260 FYENSVRHFDLKALKEQEHSYL--EIMVPTCSYRMGKSKIGLGYAVLENYNLSYTVLWQPNRFIL 322
            .:|         |.|..|....  ||.|.:   .||:.....| .|..::|.. ::.|:      
Yeast   395 TWE---------ATKNIESDVFVKEITVKS---MMGEFNGNTG-LVTGHFNTD-SMTWE------ 439

  Fly   323 LFTYVFWGLFVVCGFVV 339
                  | .|.:|.|.:
Yeast   440 ------W-TFSLCPFAI 449

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MppeNP_001286327.1 Metallophos 52..246 CDD:278574 58/309 (19%)
MPP_Cdc1_like_1 54..293 CDD:277373 69/356 (19%)
TED1NP_012225.1 MPP_Ted1 83..421 CDD:277371 70/359 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3662
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.