DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mppe and MPPE1

Sequence 1:NP_001286327.1 Gene:Mppe FlyBaseID:FBgn0259985 Length:366 Species:Drosophila melanogaster
Sequence 2:XP_006722403.1 Gene:MPPE1 HGNCID:15988 Length:397 Species:Homo sapiens

Alignment Length:422 Identity:91/423 (22%)
Similarity:156/423 (37%) Gaps:136/423 (32%)


  Fly    18 VALTLLLVFFNEFIVYYMA--QSSWQPIDCKL---DNCTR-----LLLIADPQILGNSYDRSSHS 72
            :|:...::.|.||::||:|  |.:|..:....   :..||     .:.:||..:||......   
Human    27 IAVVFAVLLFCEFLIYYLAIFQCNWPEVKTTASDGEQTTREPVLKAMFLADTHLLGEFLGHW--- 88

  Fly    73 PLARYDSDRYLAKTFERALAFTQPHIIVFLGDLLDEGNIATAQEYKQYVQRFRRIYQNKNYKKFR 137
             |.:...:..:.:.|:.||...||.::..|||:.|||..:|.:.:...|:||::::::.::.:.:
Human    89 -LDKLRREWQMERAFQTALWLLQPEVVFILGDIFDEGKWSTPEAWADDVERFQKMFRHPSHVQLK 152

  Fly   138 MISAFFQRVHVPGDNDIGGENGDYISNSNQ-RRFENEFMSEDLFDYDNRLRFFKINRMLLDFSNP 201
            :::         |::|||..   |..|:.: .|||..|.||.||.:.. :.|..:|.:.|:....
Human   153 VVA---------GNHDIGFH---YEMNTYKVERFEKVFSSERLFSWKG-INFVMVNSVALNGDGC 204

  Fly   202 DRDNNADRLRIGVSH------------------------APLLIGGGPLLRAIISD--------- 233
            ...:..:...|.|||                        ||:|:...||.|.  ||         
Human   205 GICSETEAELIEVSHRLNCSREQARGSSRCGPGPLLPTSAPVLLQHYPLYRR--SDANCSGEDAA 267

  Fly   234 ---------------------------LDPHIIFSGHWHESRIFIYPSTKVINFYENSVRHFDLK 271
                                       |.|.::.|||.|.:                        
Human   268 PAEERDIPFKENYDVLSREASQKLLWWLQPRLVLSGHTHSA------------------------ 308

  Fly   272 ALKEQEHS--YLEIMVPTCSYR-MGKSKIGLGYAVLENYNLSYTVLWQPNRFILLFTYVFWGLFV 333
              .|..|.  ..|:.||:.|:| .......:|.....:|.||...|  |...::|..|.     .
Human   309 --CEVHHGGRVPELSVPSFSWRNRNNPSFIMGSITPTDYTLSKCYL--PREDVVLIIYC-----G 364

  Fly   334 VCGFVVFKMMTR-----CPF-----RVAKRQT 355
            |.||:|...:|.     .||     .:.||:|
Human   365 VVGFLVVLTLTHFGLLASPFLSGLNLLGKRKT 396

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MppeNP_001286327.1 Metallophos 52..246 CDD:278574 56/260 (22%)
MPP_Cdc1_like_1 54..293 CDD:277373 62/303 (20%)
MPPE1XP_006722403.1 Metallophos 70..306 CDD:278574 54/255 (21%)
MPP_MPPE1 73..330 CDD:277372 62/302 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3662
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3042
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1094620at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1923
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.