DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mppe and MPPE1

DIOPT Version :9

Sequence 1:NP_001286327.1 Gene:Mppe / 36285 FlyBaseID:FBgn0259985 Length:366 Species:Drosophila melanogaster
Sequence 2:XP_006722403.1 Gene:MPPE1 / 65258 HGNCID:15988 Length:397 Species:Homo sapiens


Alignment Length:422 Identity:91/422 - (21%)
Similarity:156/422 - (36%) Gaps:136/422 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VALTLLLVFFNEFIVYYMA--QSSWQPIDCKL---DNCTR-----LLLIADPQILGNSYDRSSHS 72
            :|:...::.|.||::||:|  |.:|..:....   :..||     .:.:||..:||......   
Human    27 IAVVFAVLLFCEFLIYYLAIFQCNWPEVKTTASDGEQTTREPVLKAMFLADTHLLGEFLGHW--- 88

  Fly    73 PLARYDSDRYLAKTFERALAFTQPHIIVFLGDLLDEGNIATAQEYKQYVQRFRRIYQNKNYKKFR 137
             |.:...:..:.:.|:.||...||.::..|||:.|||..:|.:.:...|:||::::::.::.:.:
Human    89 -LDKLRREWQMERAFQTALWLLQPEVVFILGDIFDEGKWSTPEAWADDVERFQKMFRHPSHVQLK 152

  Fly   138 MISAFFQRVHVPGDNDIGGENGDYISNSNQ-RRFENEFMSEDLFDYDNRLRFFKINRMLLDFSNP 201
            :::         |::|||..   |..|:.: .|||..|.||.||.:.. :.|..:|.:.|:....
Human   153 VVA---------GNHDIGFH---YEMNTYKVERFEKVFSSERLFSWKG-INFVMVNSVALNGDGC 204

  Fly   202 DRDNNADRLRIGVSH------------------------APLLIGGGPLLRAIISD--------- 233
            ...:..:...|.|||                        ||:|:...||.|.  ||         
Human   205 GICSETEAELIEVSHRLNCSREQARGSSRCGPGPLLPTSAPVLLQHYPLYRR--SDANCSGEDAA 267

  Fly   234 ---------------------------LDPHIIFSGHWHESRIFIYPSTKVINFYENSVRHFDLK 271
                                       |.|.::.|||.|.:                        
Human   268 PAEERDIPFKENYDVLSREASQKLLWWLQPRLVLSGHTHSA------------------------ 308

  Fly   272 ALKEQEHS--YLEIMVPTCSYR-MGKSKIGLGYAVLENYNLSYTVLWQPNRFILLFTYVFWGLFV 333
              .|..|.  ..|:.||:.|:| .......:|.....:|.||...|  |...::|..|.     .
Human   309 --CEVHHGGRVPELSVPSFSWRNRNNPSFIMGSITPTDYTLSKCYL--PREDVVLIIYC-----G 364

  Fly   334 VCGFVVFKMMTR-----CPF-----RVAKRQT 355
            |.||:|...:|.     .||     .:.||:|
Human   365 VVGFLVVLTLTHFGLLASPFLSGLNLLGKRKT 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MppeNP_001286327.1 Metallophos 52..246 CDD:278574 55/259 (21%)
MPP_Cdc1_like_1 54..293 CDD:277373 62/302 (21%)
MPPE1XP_006722403.1 Metallophos 70..306 CDD:278574 54/254 (21%)
MPP_MPPE1 73..330 CDD:277372 62/301 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3662
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3042
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094620at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1923
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.