DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mppe and CPPED1

DIOPT Version :9

Sequence 1:NP_001286327.1 Gene:Mppe / 36285 FlyBaseID:FBgn0259985 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_060810.2 Gene:CPPED1 / 55313 HGNCID:25632 Length:314 Species:Homo sapiens


Alignment Length:254 Identity:48/254 - (18%)
Similarity:79/254 - (31%) Gaps:105/254 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 QPHIIVFLGDLLDEGNIATAQEYKQYVQRFRRIYQNKNYKK-FRMISAFFQRVHVPGDNDIGGEN 158
            :|...|..|||:.      |...|.:     |..|.::.|: .|.:......|.|.|::|||   
Human    81 KPKFFVLCGDLIH------AMPGKPW-----RTEQTEDLKRVLRAVDRAIPLVLVSGNHDIG--- 131

  Fly   159 GDYISNSNQRRFENEF---MSEDLFDY-DNRLRFFKINRMLLDFSNP--------------DRDN 205
                 |:.......||   ..:|.|.: ...:.|..:|...  :.||              |...
Human   132 -----NTPTAETVEEFCRTWGDDYFSFWVGGVLFLVLNSQF--YENPSKCPSLKQAQDQWLDEQL 189

  Fly   206 NADRLR-----IGVSHAPLLIGGGPLLRAIISDLDPH---------------------IIFSGHW 244
            :..|.|     |...|.||      .|.:|..|.|.:                     ::||||:
Human   190 SIARQRHCQHAIVFQHIPL------FLESIDEDDDYYFNLSKSTRKKLADKFIHAGVKVVFSGHY 248

  Fly   245 HES---------------------------RIFIYPSTKVINFYENSVRHFDLKALKEQ 276
            |.:                           |:.:..:.|:::      |::.|..|.|:
Human   249 HRNAGGTYQNLDMVVSSAIGCQLGRDPHGLRVVVVTAEKIVH------RYYSLDELSEK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MppeNP_001286327.1 Metallophos 52..246 CDD:278574 41/195 (21%)
MPP_Cdc1_like_1 54..293 CDD:277373 48/254 (19%)
CPPED1NP_060810.2 MPP_CSTP1 29..295 CDD:277340 45/246 (18%)
Catalytic 47..250 41/195 (21%)
CpdA 67..>269 CDD:224327 42/214 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.