| Sequence 1: | NP_001286327.1 | Gene: | Mppe / 36285 | FlyBaseID: | FBgn0259985 | Length: | 366 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_060810.2 | Gene: | CPPED1 / 55313 | HGNCID: | 25632 | Length: | 314 | Species: | Homo sapiens |
| Alignment Length: | 254 | Identity: | 48/254 - (18%) |
|---|---|---|---|
| Similarity: | 79/254 - (31%) | Gaps: | 105/254 - (41%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 95 QPHIIVFLGDLLDEGNIATAQEYKQYVQRFRRIYQNKNYKK-FRMISAFFQRVHVPGDNDIGGEN 158
Fly 159 GDYISNSNQRRFENEF---MSEDLFDY-DNRLRFFKINRMLLDFSNP--------------DRDN 205
Fly 206 NADRLR-----IGVSHAPLLIGGGPLLRAIISDLDPH---------------------IIFSGHW 244
Fly 245 HES---------------------------RIFIYPSTKVINFYENSVRHFDLKALKEQ 276 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Mppe | NP_001286327.1 | Metallophos | 52..246 | CDD:278574 | 41/195 (21%) |
| MPP_Cdc1_like_1 | 54..293 | CDD:277373 | 48/254 (19%) | ||
| CPPED1 | NP_060810.2 | MPP_CSTP1 | 29..295 | CDD:277340 | 45/246 (18%) |
| Catalytic | 47..250 | 41/195 (21%) | |||
| CpdA | 67..>269 | CDD:224327 | 42/214 (20%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||