DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mppe and mppe1

Sequence 1:NP_001286327.1 Gene:Mppe FlyBaseID:FBgn0259985 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001017701.1 Gene:mppe1 ZFINID:ZDB-GENE-050417-195 Length:381 Species:Danio rerio

Alignment Length:437 Identity:98/438 (22%)
Similarity:153/438 (35%) Gaps:158/438 (36%)


  Fly    14 CRGFVALTLLLVF-----FNEFIVYYMA--QSSWQPIDCKLDNCTRLLLIADPQILGNSYDRSSH 71
            ||  :|:||:..|     |.|:::||:.  :.||.           ||.|.|           ||
Zfish     9 CR--LAVTLIFAFVSVFVFCEYVIYYLVILRCSWP-----------LLEIED-----------SH 49

  Fly    72 SPL-ARYDSDRYL------------------AKTFERALAFTQPHIIVFLGDLLDEGNIATAQEY 117
            ||| |.:.||.:|                  .:.|:.::....|.::..|||:.|||..:|:|::
Zfish    50 SPLRALFLSDTHLLGAIRGHWLDKLRREWQMERAFQTSMWLLNPEVVFILGDVFDEGKWSTSQDW 114

  Fly   118 KQYVQRFRRIYQNKNYKKFRMISAFFQRVHVPGDNDIGGENGDYISNSNQRRFENEF--MSEDLF 180
            :..|:||:||:::....|.         |.:.|::|||..:  .::.....|||..|  .|..:.
Zfish   115 EDDVRRFKRIFRHPVDTKL---------VVLVGNHDIGFHH--EMTKQKLERFEQVFNVTSARIL 168

  Fly   181 DYDNRLRFFKINRMLLDFSN-PDRDNNADRLR----------IGVSH-------------APLLI 221
            .... :.|..:|.:.|...: |...:..:.|:          .|..|             ||:|:
Zfish   169 TIKG-VNFLLVNSVALHGDHCPICQHVEEELQKLSHALNCSIQGAQHNGQCKNAARFAPAAPVLL 232

  Fly   222 GGGPLLRAIISD----------LD--------------------------PHIIFSGHWHESRIF 250
            ...||.|  :||          ||                          |.:|.|||.|..   
Zfish   233 QHYPLYR--VSDAMCTGVDTAPLDEQYLLFQERYDVISKNASKKLLWWFKPRLILSGHTHNG--- 292

  Fly   251 IYPSTKVINFYENSVRHFDLKALKEQEHSYLEIMVPTCSYR-MGKSKIGLGYAVLENYNLSYTVL 314
                        ..|.|         |..|.||.||:.|:| .......||......:.||...|
Zfish   293 ------------CEVLH---------EKLYPEISVPSFSWRNRNNPSFVLGTFSQSEFQLSKCFL 336

  Fly   315 WQPNRFILLFTYVFWGLFVVCGFVVFKMMTRCPFR-----VAKRQTL 356
              |....:|..|....|.:....::...|.|...:     :.|.:||
Zfish   337 --PEERTVLVVYCSSCLIIALITLIHLKMFRNSLQFTNNLIGKHKTL 381

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MppeNP_001286327.1 Metallophos 52..246 CDD:278574 62/275 (23%)
MPP_Cdc1_like_1 54..293 CDD:277373 71/321 (22%)
mppe1NP_001017701.1 Metallophos 52..290 CDD:278574 53/252 (21%)
MPP_MPPE1 55..314 CDD:277372 62/297 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3662
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1094620at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1923
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.