DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mppe and Mppe1

Sequence 1:NP_001286327.1 Gene:Mppe FlyBaseID:FBgn0259985 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001101905.1 Gene:Mppe1 RGDID:1309184 Length:394 Species:Rattus norvegicus

Alignment Length:400 Identity:81/400 (20%)
Similarity:149/400 (37%) Gaps:112/400 (28%)


  Fly     3 SLRVVNRNRLVCRGFVALTLLLVFFNEFIVYYMA--QSSWQPIDC-----KLDNCTRLLLIADPQ 60
            :..::.|.|::......:.:.::.|.|:.:||:.  :..|..:..     :.:...:.:.:||..
  Rat    12 NFHLLRRRRVLLLKLTVVVISVLLFCEYFIYYLVLFRCHWPEVKMPARGGRQEPVLKAMFLADTH 76

  Fly    61 ILGNSYDRSSHSPLARYDSDRYLAKTFERALAFTQPHIIVFLGDLLDEGNIATAQEYKQYVQRFR 125
            :||   :...|. |.:...:..:.:.|:.||...||.::..|||:.|||..::||.:...:.||:
  Rat    77 LLG---EIRGHW-LDKLRREWQMERAFQTALWLLQPEVVFILGDVFDEGKWSSAQAWADDLHRFQ 137

  Fly   126 RIYQNKNYKKFRMISAFFQRVHVPGDNDIGGENGDYISNSNQRRFENEFMSEDLFDYDNRLRFFK 190
            |::::.::.:.::         |.|::|||...  .:|.....|||..|.||.||.... :.|..
  Rat   138 RMFRHGSHVQLKV---------VIGNHDIGFHY--QMSKYRINRFEKVFGSERLFSLKG-VNFVM 190

  Fly   191 INRMLL-------------DFSNPDRDNNADRLRI-GVSH----------APLLIGGGPLLRAII 231
            :|.:.:             :.....|..|..:.:: |.|.          ||:|:...||.||  
  Rat   191 VNSVAMEGDGCTICSEAEAELREISRKLNCSQEQVQGSSQCDHEPRLPLSAPVLLQHYPLYRA-- 253

  Fly   232 SD------------------------------------LDPHIIFSGHWHESRIFIYPSTKVINF 260
            ||                                    |.|.:|.|||.|.:...::|.      
  Rat   254 SDANCSGEDAAPPEERSVPFEEKYDVLSREASQKLLWWLRPRLILSGHTHSACEVLHPG------ 312

  Fly   261 YENSVRHFDLKALKEQEHSYLEIMVPTCSYR-MGKSKIGLGYAVLENYNLSYTVLWQPNRFILLF 324
                              ...|:.||:.|:| .......:|.....:|.||...|  |....:|.
  Rat   313 ------------------GAPEVSVPSFSWRNRNNPSFIMGSLTSRDYALSKCYL--PCEDTVLT 357

  Fly   325 TYVFWGLFVV 334
            ||.....|::
  Rat   358 TYCAAAAFLL 367

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MppeNP_001286327.1 Metallophos 52..246 CDD:278574 58/254 (23%)
MPP_Cdc1_like_1 54..293 CDD:277373 64/300 (21%)
Mppe1NP_001101905.1 Metallophos 67..303 CDD:278574 57/254 (22%)
MPP_MPPE1 70..327 CDD:277372 64/299 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3662
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1094620at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.