DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mppe and SPAC23A1.02c

Sequence 1:NP_001286327.1 Gene:Mppe FlyBaseID:FBgn0259985 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_594432.1 Gene:SPAC23A1.02c PomBaseID:SPAC23A1.02c Length:430 Species:Schizosaccharomyces pombe

Alignment Length:434 Identity:79/435 (18%)
Similarity:151/435 (35%) Gaps:137/435 (31%)


  Fly    17 FVALTLLLVFFNEFIVYYMAQSSWQPIDCKLDNCTRLLLIADPQILGNSYDRSS---HSPLARYD 78
            ::.|..|.|::...:::.:.....|..|   :|...::.:|||||.||....::   ...|..:.
pombe    20 YLCLVFLAVYYAYPLLFGIMPRKLQLED---ENSFVIMGVADPQIEGNHKIEANGFFKGTLDLWG 81

  Fly    79 SDRYLAKTFERALAFTQPHIIVFLGDLLDEGNIATAQEYKQYVQRFRRIYQNKNYKKF---RMIS 140
            :|.:|.........:.||..::.||||:...::.. :|:.:..:|.::|...||:.:.   .:.:
pombe    82 NDLFLRHLVHMNQFWGQPDAMILLGDLVSFQHLDN-EEFNKRAKRLKKITGAKNFWQVGNSSLPA 145

  Fly   141 AFFQRVHVP-----GDNDI--GGENGD--------------YISNSNQRRFE------NEFMSED 178
            ..|:..::|     |::||  |.|:.|              ::|:.|..:|.      |....:|
pombe   146 RTFENGNIPVWTIAGNHDIGYGCESSDAQISKWEQAMGPVNWVSHFNVSKFPVRVIGINSLSLDD 210

  Fly   179 LFDYD-------NRLRFFKINRMLLDFSNPDRDNNADRLRIGVSHAPLLIGGGPLLRAIISDLDP 236
            :..||       |...|..:.  :|..|...||  |.:....::..|.:               |
pombe   211 VQFYDANPSDIINSKSFSSLG--ILALSKEARD--AWQFLFDIALEPSI---------------P 256

  Fly   237 HIIFSGHWHESRIFIYPSTKVINFYENSVRHFDLKALKEQEH-SYLEIM-----VPT-------- 287
            .|:|      :.:.:|....|.......||..|.: :|.|.| ||...|     :|:        
pombe   257 TILF------THVPLYKPANVCVDEPRIVRQLDFR-VKSQNHLSYNTTMKIFELIPSIKLVLSGH 314

  Fly   288 ----CSYR-------------MGKSKIGLGYAVLENYNLSYTVLWQPNRFILLF----------- 324
                |.|.             ||.....:|:..|...|...|...:....::.|           
pombe   315 DHMGCDYEHPNGAIEHTLPSAMGYFGGNIGFVKLIATNDVLTESSKNTPSVVTFLIQKLIGQRWK 379

  Fly   325 ------------------------TYVFWGLFV-VCGFVVFKMM 343
                                    :|::|.|.: ||...:.:::
pombe   380 KASLKQSKFSSDIYATYTLSHGGPSYIWWALHISVCVLTILRLL 423

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MppeNP_001286327.1 Metallophos 52..246 CDD:278574 47/234 (20%)
MPP_Cdc1_like_1 54..293 CDD:277373 62/310 (20%)
SPAC23A1.02cNP_594432.1 MPP_Ted1 54..340 CDD:277371 63/313 (20%)
Metallophos 86..316 CDD:278574 50/257 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1923
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.