DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mppe and Mppe1

Sequence 1:NP_001286327.1 Gene:Mppe FlyBaseID:FBgn0259985 Length:366 Species:Drosophila melanogaster
Sequence 2:XP_011245209.1 Gene:Mppe1 MGIID:2661311 Length:420 Species:Mus musculus

Alignment Length:398 Identity:75/399 (19%)
Similarity:138/399 (35%) Gaps:141/399 (35%)


  Fly     9 RNRLVCRGFVALTLLLVFFNEFIVYYMA--QSSWQPIDC-----KLDNCTRLLLIADPQILGNSY 66
            |.|.:......:.:.::.|.|:.:||:.  :..|..:..     :.:...:.:.:||..:||   
Mouse    19 RRRALLLKLTVVIISVLLFCEYFIYYLVLFRCHWPEVKTLAHGGRQEPVLKAMFLADTHLLG--- 80

  Fly    67 DRSSHSPLARYDSDRYLAKTFERALAFTQPHIIVFLGDLLDEGNIATAQEYKQYVQRFRRIYQNK 131
            :...|. |.:...:..:.:.|:.||...||.::..|||:.|||..::.|.:...||||:|::::.
Mouse    81 EIRGHW-LDKLRREWQMERAFQTALWLLQPEVVFILGDIFDEGKWSSDQAWADDVQRFQRMFRHD 144

  Fly   132 NYKKFRMISAFFQRVHVPGDNDIGGENGDYISNSNQRRFENEFMSEDLFD--------------- 181
            ::.:.::         |.|::|:|...  .:|....:|||..|.||.|..               
Mouse   145 SHVQLKV---------VIGNHDVGFHY--QMSKYRIKRFEKVFGSERLLSLKGVKQDLSMLPLQR 198

  Fly   182 -------YDNRLRFFKINRMLLD------------------------------FSNPDRDNNADR 209
                   |.:...|..:|.:.::                              .|..||:...  
Mouse   199 QTPELGLYPHLHSFVMVNSVAMEGDGCIICSEEEAELREISRKLNCSQEQVPGSSQCDREPEP-- 261

  Fly   210 LRIGVSHAPLLIGGGPLLRAIISD------------------------------------LDPHI 238
             |:.:| ||:|:...||.||  ||                                    |.|.:
Mouse   262 -RLPLS-APVLLQHYPLYRA--SDANCSGEDAAPPEERNVPFEEKYDVLSREASQKLLWWLRPRL 322

  Fly   239 IFSGHWHESRIFIYPSTKVINFYENSVRHFDLKALKEQEHSYLEIMVPTCSYR-MGKSKIGLGYA 302
            :.|||.|.:...::|.                        ...|:.||:.|:| .......:|..
Mouse   323 VLSGHTHSACEVLHPG------------------------GAPEVSVPSFSWRNRNNPSFIMGSL 363

  Fly   303 VLENYNLS 310
            ...:|.||
Mouse   364 TSRDYALS 371

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MppeNP_001286327.1 Metallophos 52..246 CDD:278574 58/282 (21%)
MPP_Cdc1_like_1 54..293 CDD:277373 64/328 (20%)
Mppe1XP_011245209.1 Metallophos 68..>188 CDD:278574 35/135 (26%)
MPP_MPPE1 71..353 CDD:277372 64/327 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3662
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3042
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1923
TreeFam 00.000 Not matched by this tool.
32.880

Return to query results.
Submit another query.