DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mppe and ZK792.7

Sequence 1:NP_001286327.1 Gene:Mppe FlyBaseID:FBgn0259985 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_502214.2 Gene:ZK792.7 WormBaseID:WBGene00014079 Length:342 Species:Caenorhabditis elegans

Alignment Length:372 Identity:110/373 (29%)
Similarity:171/373 (46%) Gaps:62/373 (17%)


  Fly     4 LRVVNRNRLVCRGFVALTL-LLVFFNEFIVYYMAQSSWQPIDCKLDNCTRLLLIADPQILGNSYD 67
            :|..:..|....|..||.| .::.:||...|:.....| |...:...|.|:|::||||::|  |.
 Worm     1 MRQSSSRRAFIYGIPALVLAFVILWNESWSYWWLSRQW-PEHEENGRCDRILIVADPQLIG--YK 62

  Fly    68 RSSHSPLARYDSDRYLAKTFERALAFTQPHIIVFLGDLLDEGNIATAQEYKQYVQRFRRIYQNKN 132
            ......::|:|||||||..:..|.....|..::|||||.|||..:...|:.:..:||..||.   
 Worm    63 NEKFGEISRWDSDRYLATGYSYAKWRFLPTTVMFLGDLFDEGIESNDDEWYETYERFIGIYP--- 124

  Fly   133 YKKFRMISAFFQRVHVPGDNDIGGENGDYISNSNQRRFENEFMSEDLFDYDNRLRFFKINRMLLD 197
                  |......:::.||||||||: :.||.|.:.:|.|.|.: ::.|..:|   :.|:...| 
 Worm   125 ------IDRGDNAIYIAGDNDIGGES-ELISESRRNQFYNYFRN-NVSDLKDR---YSISETYL- 177

  Fly   198 FSNPDRDN----NADRLRIGVSHAPLLIGGGPLLRAIISDLDP--HIIFSGHWHESRIFIYPS-- 254
            |.||...:    .....:|.::|.|.|:.|..     .||:..  .:|.|.|.|.:.|:.|..  
 Worm   178 FENPILKHITKAQVPVAKIMLTHVPYLVEGYK-----HSDVGQKMDLILSAHDHTTGIYEYQRSA 237

  Fly   255 ------TKVIN----FYENSVRHFDLKALKEQEHSYLEIMVPTCSYRMGKSKIGLGYAVLENYN- 308
                  |:|.:    :::|.          .|....:|:..||||||||...:|.|...:...| 
 Worm   238 PRAVLFTRVSDVSPTYFKNI----------GQNEPLIELQTPTCSYRMGVYSMGYGALSICRLND 292

  Fly   309 ------LSYTVLWQPNRFILLFTYVFWGLFVVCGFVVFKMMTRCPFR 349
                  :.|:|||.|:||..||.|:| .|.....:::|:  .||..|
 Worm   293 DYRSVQVQYSVLWLPSRFAQLFLYIF-SLIFSAFWIIFQ--KRCRTR 336

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MppeNP_001286327.1 Metallophos 52..246 CDD:278574 64/200 (32%)
MPP_Cdc1_like_1 54..293 CDD:277373 77/257 (30%)
ZK792.7NP_502214.2 MPP_Cdc1_like_1 51..276 CDD:277373 77/257 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C196581521
eggNOG 1 0.900 E1_KOG3662
Hieranoid 1 1.000
Homologene 1 1.000 H45262
Inparanoid 1 1.050 130 1.000 Inparanoid score I3175
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1094620at2759
OrthoFinder 1 1.000 FOG0013865
OrthoInspector 1 1.000 T477325
orthoMCL 1 0.900 OOG5_142347
Panther 1 1.100 LDO PTHR13315
Phylome 1 0.910 0.929 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1923
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.