DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mppe and mppe-1

Sequence 1:NP_001286327.1 Gene:Mppe FlyBaseID:FBgn0259985 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001251443.1 Gene:mppe-1 WormBaseID:WBGene00015238 Length:365 Species:Caenorhabditis elegans

Alignment Length:396 Identity:86/397 (22%)
Similarity:155/397 (39%) Gaps:107/397 (27%)


  Fly    18 VALTLLLVFFNEFIVYYMAQSSWQ-PIDCKLDNCT----RLLLIADPQILGNSYDRSSHSPLARY 77
            :.|.::||.:||:.::::|.||.| |  ||...|:    :..:|:|..:||..   :.|. |.:.
 Worm    11 ILLAIILVVYNEYFIFFIAFSSCQWP--CKYGRCSESSVKAFMISDTHLLGKI---NGHW-LDKL 69

  Fly    78 DSDRYLAKTFERALAFTQPHIIVFLGDLLDEGNIATAQEYKQYVQRFRRIYQNKNYKKFRMISAF 142
            ..:..:.::|..:.....|.:..|||||:|||..|....::.|.:||::::.:..          
 Worm    70 KREWQMYQSFWISTWIHSPDVTFFLGDLMDEGKWAGRPVFEAYAERFKKLFGDNE---------- 124

  Fly   143 FQRVHVPGDNDIGGENGDYISNSNQRRFENEFMSEDLFD--YDNRLRFFKINRMLLDFSNPDRDN 205
             :.:.:.|::|:|....  |.......|:.|| ...|.|  ...:.||..||.|.:         
 Worm   125 -KVITLAGNHDLGFHYA--IMPETLEMFKKEF-RRGLIDEMKIKKHRFVLINSMAM--------- 176

  Fly   206 NADRLRI--------------GVSHAPLLIGGGPLLR---------------------------- 228
            :.|..|:              ...:.|:::...||.|                            
 Worm   177 HGDGCRLCHEAELILEKIKSRNPKNRPIVLQHFPLYRKSDAECDQVDEQHEIDLKEMYREQWDTL 241

  Fly   229 ------AIISDLDPHIIFSGHWHESRIFIYPSTKVINFYENSVRHFDLKALKEQEHSYLEIMVPT 287
                  .||..|:|..:|.||.|:.      ..|..|...||            |:.| |..|.:
 Worm   242 SKESSLQIIDSLNPKAVFGGHTHKM------CKKKWNKTGNS------------EYFY-EYTVNS 287

  Fly   288 CSYRMGKSKIGLGYAVLENYNLSYTVLWQPNRFILLFTYVFWGLFVVCGFVVFKMMTRCPFRVAK 352
            .|:|.|.....| ..|::..|:..:....|:..:.:..|:|.|:.:|  .:.|.:::| ..|:.|
 Worm   288 FSWRNGDVPAML-LVVIDGDNVLVSSCRLPSEILQIMVYIFGGIGIV--ILAFILISR-RVRIFK 348

  Fly   353 RQTLYN 358
            |:..|:
 Worm   349 RRPSYS 354

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MppeNP_001286327.1 Metallophos 52..246 CDD:278574 48/244 (20%)
MPP_Cdc1_like_1 54..293 CDD:277373 58/289 (20%)
mppe-1NP_001251443.1 MPP_superfamily 51..292 CDD:301300 58/287 (20%)
Metallophos 52..266 CDD:278574 48/241 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3662
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3042
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1094620at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1923
TreeFam 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.