DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mppe and mppe1

Sequence 1:NP_001286327.1 Gene:Mppe FlyBaseID:FBgn0259985 Length:366 Species:Drosophila melanogaster
Sequence 2:XP_002936127.1 Gene:mppe1 XenbaseID:XB-GENE-987928 Length:399 Species:Xenopus tropicalis

Alignment Length:424 Identity:92/425 (22%)
Similarity:159/425 (37%) Gaps:137/425 (32%)


  Fly     1 MASLR----------VVNRNRLVCRGFVALTLLLVFFNEFIVYYM--AQSSWQPID--CKLDN-- 49
            |.|||          :..|...:|..|.:: ||:.||.||:|||:  .:.||..:.  .|.|:  
 Frog     6 MVSLRTGFSKKRTAYLKTRLFFLCSIFGSI-LLVFFFCEFLVYYLVIVKCSWPEVKGAHKEDSTP 69

  Fly    50 CTRLLLIADPQIL----GNSYDRSSHSPLARYDSDRYLAKTFERALAFTQPHIIVFLGDLLDEGN 110
            ..:.:.:||..:|    |:.:|:     |.|   :..:.::::.||...||.::..|||:.|||.
 Frog    70 VLKAMFLADTHLLGEIRGHWFDK-----LRR---EWQMERSYQSALWLLQPDVVFILGDIFDEGK 126

  Fly   111 IATAQEYKQYVQRFRRIYQNKNYKKFRMISAFFQRVHVPGDNDIGGENGDYISNSNQ-RRFEN-- 172
            .:..:.:.:.|.||::::::..:.:.         :.:.|::|||..   |..|..: .|||.  
 Frog   127 WSIPEAWSRDVVRFQKMFRHPPHTEL---------IVLVGNHDIGFH---YDMNIYKLSRFEKTF 179

  Fly   173 EFMSEDLFDYDNRLRFFKINRMLLDFSNPD----RDNNADRLRIGVS------------------ 215
            .|.|..|..... :.|..:|.:.|:..:.|    .:|..:|:...:|                  
 Frog   180 NFTSGKLVSLKG-INFVLLNSVALEGDDCDICRAAENQLERISTKLSCSRMREHPDFRKKCKNVE 243

  Fly   216 ----HAPLLIGGGPLLRAIISDLD------------------------------------PHIIF 240
                .||:|:...||.|  .|||:                                    |.:|.
 Frog   244 KTPMSAPILLQHYPLYR--FSDLECTGEDSASPEEKKVLFREKYDVLSQDASKKLLQLLQPRLIL 306

  Fly   241 SGHWHESRIFIYPSTKVINFYENSVRHFDLKALKEQEHSYLEIMVPTCSYR-MGKSKIGLGYAVL 304
            |||.|.:               ..|.|         :....||.||:.|:| .......:|....
 Frog   307 SGHTHSA---------------CEVLH---------QGKIPEISVPSFSWRNRNNPSFIMGSITA 347

  Fly   305 ENYNLSYTVLWQPNRFILLFTYV---FWGLFVVC 335
            .||:|:...|.:.|..|.::..|   |....:.|
 Frog   348 ANYSLAKCFLPKENMIIYIYCTVGTLFTSYVLAC 381

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MppeNP_001286327.1 Metallophos 52..246 CDD:278574 54/263 (21%)
MPP_Cdc1_like_1 54..293 CDD:277373 62/309 (20%)
mppe1XP_002936127.1 Metallophos 71..311 CDD:278574 53/263 (20%)
MPP_MPPE1 74..335 CDD:277372 62/308 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3662
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1094620at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.