DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk and ROBO3

DIOPT Version :10

Sequence 1:NP_523705.2 Gene:otk / 36283 FlyBaseID:FBgn0004839 Length:1033 Species:Drosophila melanogaster
Sequence 2:NP_071765.2 Gene:ROBO3 / 64221 HGNCID:13433 Length:1386 Species:Homo sapiens


Alignment Length:717 Identity:162/717 - (22%)
Similarity:258/717 - (35%) Gaps:210/717 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 LLGSNRNELLLKCHVEGASGDLEPLEIEWYRNSEKLSTWKNVQLD--QHRLII------------ 175
            ||.|......|.|..||..   .| .||||:|..:::|   |:.|  .|||::            
Human    73 LLVSRGEPATLPCRAEGRP---RP-NIEWYKNGARVAT---VREDPRAHRLLLPSGALFFPRIVH 130

  Fly   176 RQPGSEDDGLYRCTASNAAGRVMSKQGYVYQSSVKCLPRLPRRKNEKMMESWDKQTFLCRGKRGG 240
            .:....|:|:|.|.|.|..|...|:.                                       
Human   131 GRRARPDEGVYTCVARNYLGAAASRN--------------------------------------- 156

  Fly   241 AAGLEALPAAPEDLRIVQGPIGQSIIKEGEPTALTCLYELPDELKNQRIQLRWRKDGKLLRQVEL 305
             |.|| :....:|.|  |.| |..::..|||..|.|   :|.. .:....:.|||||..|::   
Human   157 -ASLE-VAVLRDDFR--QSP-GNVVVAVGEPAVLEC---VPPR-GHPEPSVSWRKDGARLKE--- 209

  Fly   306 GGSAPIPGHSFDSGKDALLREDARLVLHKQNGTLSFASIIASDAGQYQCQLQLEAHAPINSSPGI 370
                                |:.|:.:  :.|.|..:..:.||||.|.|.....|....:::..:
Human   210 --------------------EEGRITI--RGGKLMMSHTLKSDAGMYVCVASNMAGERESAAAEV 252

  Fly   371 LEVIEQLKFVPQPTSKNLELDAVVAKVHCKAQGTPTPQVQWVR-DGENTTLPDHVEVDANGTLIF 434
            : |:|:..|:.:|.::.:..||.|..: |:.:|.|.|:::|.: |||..|  ...|:.::.:|..
Human   253 M-VLERPSFLRRPVNQVVLADAPVTFL-CEVKGDPPPRLRWRKEDGELPT--GRYEIRSDHSLWI 313

  Fly   435 RNVNSEHRGNYTCLATNSQGQINATVAINVVVTPKFSVPPVGPIETSEQGTVVMHCQAIGDPKPT 499
            .:|::|..|.|||:|.||.|:..|:.:::|.|.|:....|...:....: :|...|:..|:|.|.
Human   314 GHVSAEDEGTYTCVAENSVGRAEASGSLSVHVPPQLVTQPQDQMAAPGE-SVAFQCETKGNPPPA 377

  Fly   500 IQWDKD----LKYLSENNTDRERFRFLENGTLEIRNVQVEDEGSYGCTIGNSAGLKREDVQLVVK 560
            |.|.|:    |.:.|::.....||.....|.|.|..||..|.|.|.|...:.||.......|.:|
Human   378 IFWQKEGSQVLLFPSQSLQPTGRFSVSPRGQLNITAVQRGDAGYYVCQAVSVAGSILAKALLEIK 442

  Fly   561 TTG-DGFAPEESGGDGFLVTRAVLITMTVALAYIVLVVGLMLWCRYRRQARKARLNDLSTKEAGG 624
            ... ||..|....|.                |...||:|..:|              |..:..|.
Human   443 GASLDGLPPVILQGP----------------ANQTLVLGSSVW--------------LPCRVTGN 477

  Fly   625 DQPDVAGNGKGSEQEPCLSKQHNGHSKSRSKSSGDAQKSDDTACSQQSRASKKSAHIYEQ----- 684
            .||.|                       |.|..|...:.||......:..:...|::.|.     
Human   478 PQPSV-----------------------RWKKDGQWLQGDDLQFKTMANGTLYIANVQEMDMGFY 519

  Fly   685 LALPRSGLSELIQIG----RGEFGDVFVGKLKATLVTSPS-----------DKDADTEKQHSNSE 734
            ..:.:|...|....|    |.::|   |.....|..:||.           .|::.|.....|.:
Human   520 SCVAKSSTGEATWSGWLKMREDWG---VSPDPPTEPSSPPGAPSQPVVTEITKNSITLTWKPNPQ 581

  Fly   735 NGSG---------GSGSGSTTLSTLNEKRRSKTSMDDIEEIKEEEQDQHNQSGLE----QLVLVK 786
            .|:.         ...:|:|.          :|..|.:      :.:.|..|||:    .|.||:
Human   582 TGAAVTSYVIEAFSPAAGNTW----------RTVADGV------QLETHTVSGLQPNTIYLFLVR 630

  Fly   787 AL 788
            |:
Human   631 AV 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otkNP_523705.2 Ig_3 31..99 CDD:464046
Ig strand B 133..137 CDD:409353 1/3 (33%)
Ig <135..197 CDD:472250 23/75 (31%)
Ig strand C 150..154 CDD:409353 2/3 (67%)
Ig strand E 171..175 CDD:409353 3/3 (100%)
Ig strand F 185..190 CDD:409353 2/4 (50%)
Ig 265..360 CDD:472250 22/94 (23%)
Ig strand B 272..276 CDD:409571 1/3 (33%)
Ig strand C 290..294 CDD:409571 0/3 (0%)
Ig strand E 337..341 CDD:409571 2/3 (67%)
Ig strand F 351..356 CDD:409571 2/4 (50%)
Ig 395..460 CDD:409353 22/65 (34%)
Ig strand B 395..399 CDD:409353 0/3 (0%)
Ig strand C 408..412 CDD:409353 0/3 (0%)
Ig strand E 430..434 CDD:409353 1/3 (33%)
Ig strand F 444..449 CDD:409353 3/4 (75%)
Ig strand G 457..460 CDD:409353 1/2 (50%)
I-set 468..559 CDD:400151 26/94 (28%)
Ig strand B 486..490 CDD:409570 1/3 (33%)
Ig strand C 499..503 CDD:409570 1/3 (33%)
Ig strand E 525..529 CDD:409570 2/3 (67%)
Ig strand F 539..544 CDD:409570 2/4 (50%)
Ig strand G 552..555 CDD:409570 0/2 (0%)
PTK_CCK4 686..1026 CDD:133178 25/131 (19%)
ROBO3NP_071765.2 Ig 64..162 CDD:472250 30/136 (22%)
Ig strand B 81..85 CDD:409353 1/3 (33%)
Ig strand C 94..98 CDD:409353 2/3 (67%)
Ig strand E 121..125 CDD:409353 0/3 (0%)
Ig strand F 140..145 CDD:409353 2/4 (50%)
Ig strand G 154..157 CDD:409353 1/42 (2%)
Ig 169..254 CDD:472250 27/117 (23%)
Ig strand B 183..187 CDD:409353 1/3 (33%)
Ig strand C 197..201 CDD:409353 0/3 (0%)
Ig strand E 219..223 CDD:409353 2/3 (67%)
Ig strand F 233..238 CDD:409353 2/4 (50%)
Ig strand G 247..250 CDD:409353 0/2 (0%)
Ig 261..343 CDD:472250 26/84 (31%)
Ig strand B 275..279 CDD:409353 1/4 (25%)
Ig strand C 288..292 CDD:409353 0/3 (0%)
Ig strand E 309..313 CDD:409353 1/3 (33%)
Ig strand F 323..328 CDD:409353 3/4 (75%)
Ig strand G 336..339 CDD:409353 1/2 (50%)
Ig 348..445 CDD:472250 26/97 (27%)
Ig strand B 364..368 CDD:409353 1/3 (33%)
Ig strand C 377..381 CDD:409353 1/3 (33%)
Ig strand E 407..411 CDD:409353 2/3 (67%)
Ig strand F 421..426 CDD:409353 2/4 (50%)
Ig strand G 434..437 CDD:409353 0/2 (0%)
Ig 452..536 CDD:472250 21/136 (15%)
Ig strand B 468..472 CDD:409353 2/17 (12%)
Ig strand C 481..485 CDD:409353 2/26 (8%)
Ig strand E 504..508 CDD:409353 0/3 (0%)
FN3 <518..>809 CDD:442628 25/134 (19%)
Ig strand F 518..523 CDD:409353 0/4 (0%)
Ig strand G 531..534 CDD:409353 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 541..563 5/24 (21%)
FN3 556..649 CDD:238020 16/93 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 639..662
FN3 770..863 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 965..989
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1028..1310
PRK12323 <1126..1325 CDD:481241
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1327..1386
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.