DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk and tutl

DIOPT Version :10

Sequence 1:NP_523705.2 Gene:otk / 36283 FlyBaseID:FBgn0004839 Length:1033 Species:Drosophila melanogaster
Sequence 2:NP_001303307.1 Gene:tutl / 46015 FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster


Alignment Length:711 Identity:169/711 - (23%)
Similarity:265/711 - (37%) Gaps:192/711 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ISICGLVMALMMASVLASSSRFQRVPQSQ---SVVENESVKFECESTDSYSELHYDWLHNGHRIA 67
            |.:...|:..::| :||.:::...:|:..   :.:..|.|.|.|         |.:: .|.|.:.
  Fly   108 IQVLQFVLVSLLA-LLAKNAQAHNIPEDAVHITAILGEGVIFNC---------HVEF-PNDHPVP 161

  Fly    68 Y----DKRVHQIGSNL-----------HIE-----------------------AVRRTEDVGNYV 94
            |    ||:|.:.||:|           |||                       ...|..|.|.|.
  Fly   162 YVLQWDKKVSETGSDLPIYIWYESYPEHIEEGYKGRVSRVSQDSPFGSASLNLTNIRESDQGWYE 226

  Fly    95 CIATNLASGAR----------EASPPAKLSV-----IYLESASVQLLGSNRNELLLKCHVEGASG 144
            |....|....:          :...|.:.||     ||:.      ||   :.::|.|..:|...
  Fly   227 CKVVFLNRDPKQHKNGTWFHLDVHAPPRFSVTPEDIIYVN------LG---DSIILNCQADGTPT 282

  Fly   145 DLEPLEIEWYRNSEKLSTWKNVQL--DQHRLIIRQPGSEDDGLYRCTASNAAGRVMSKQGYVYQS 207
            .    ||.||:::..:.....|.:  |...|.|.....||.|.|.|.|.|..|:|......:.  
  Fly   283 P----EILWYKDANPVDPSPTVGIFNDGTELRISTIRHEDIGEYTCIARNGEGQVSHTARVII-- 341

  Fly   208 SVKCLPRLPRRKNEKMMESWDKQTFLCRGKRGGAAGLEALPAAPEDLRIVQGPIGQSIIKEGEPT 272
                                          .|||.             |:..|..|:.: |||..
  Fly   342 ------------------------------AGGAV-------------IMVPPTNQTKL-EGEKV 362

  Fly   273 ALTCLYELPDELKNQ--RIQLRWRKDGKLLRQVELGGSAPIPGHSFDSGKDALLREDARLVLHKQ 335
            ..:|      |.|..  .:.:||.::|..:|:|                  |.|  :.|:.:.| 
  Fly   363 IFSC------EAKAMPGNVTVRWYREGSPVREV------------------AAL--ETRVTIRK- 400

  Fly   336 NGTLSFASIIASDAGQYQCQLQLEAHAPINSSPGILEVIEQLKFVPQPTSKNLELDAVVAKVHCK 400
            :|:|....|...|:|||.|::......| .|:...|.|....|....||.:.|.. .:...|.|.
  Fly   401 DGSLIINPIKPDDSGQYLCEVTNGIGDP-QSASAYLSVEYPAKVTFTPTVQYLPF-RLAGVVQCY 463

  Fly   401 AQGTPTPQ-VQWVRDG---ENTTLPDHVEVDANGTLIFRNVNSEHRGNYTCLATNSQGQINATVA 461
            .:.:|..| |.|.:|.   |...:.| :.|.|||:|:|..||.||:|.|.|...|:||...|:..
  Fly   464 IKSSPQLQYVTWTKDKRLLEPYQMKD-IVVMANGSLLFTRVNEEHQGQYACTPYNAQGTAGASGV 527

  Fly   462 INVVV--TPKFSVPPVGPIETSEQGTVVMHCQAI---GDPKPTIQWDKDLKYLSENNTDRERFRF 521
            ::|:|  .|.|:|.|....:.....:|.|||.|:   |..:|||:|.:.   ..|..|:.:|.|.
  Fly   528 MDVLVRKPPAFTVEPETLYQRKVGDSVEMHCDALEAEGTERPTIKWQRQ---EGEQLTESQRNRI 589

  Fly   522 -LENGTLEIRNVQVEDEGSYGCTIGNSAGLKREDVQLVVKTTGDGFAPEESGGDGFLVTRAVLIT 585
             :..|.:.|.|::.||.|.|.|.:.|.........|||::.| ...||....|      :|...:
  Fly   590 KISGGNITIENLRREDFGYYQCVVSNEVATLMAVTQLVIEGT-QPHAPYNITG------KATESS 647

  Fly   586 MTVALAYIVLVVGLMLWCRYRRQ----ARKARLND---LSTKEAGGDQPDVAGNGKGSEQE 639
            :|     :..:.|......|::.    .|:|.:||   :|...:|..|..:.|...|:..|
  Fly   648 IT-----LQWLPGYSGGSEYKQDYTIWFREAGVNDWQTISVTPSGSTQVTINGLASGTTYE 703

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otkNP_523705.2 Ig_3 31..99 CDD:464046 23/108 (21%)
Ig strand B 133..137 CDD:409353 1/3 (33%)
Ig <135..197 CDD:472250 19/63 (30%)
Ig strand C 150..154 CDD:409353 2/3 (67%)
Ig strand E 171..175 CDD:409353 1/3 (33%)
Ig strand F 185..190 CDD:409353 2/4 (50%)
Ig 265..360 CDD:472250 23/96 (24%)
Ig strand B 272..276 CDD:409571 0/3 (0%)
Ig strand C 290..294 CDD:409571 1/3 (33%)
Ig strand E 337..341 CDD:409571 2/3 (67%)
Ig strand F 351..356 CDD:409571 3/4 (75%)
Ig 395..460 CDD:409353 26/68 (38%)
Ig strand B 395..399 CDD:409353 1/3 (33%)
Ig strand C 408..412 CDD:409353 2/4 (50%)
Ig strand E 430..434 CDD:409353 2/3 (67%)
Ig strand F 444..449 CDD:409353 2/4 (50%)
Ig strand G 457..460 CDD:409353 1/2 (50%)
I-set 468..559 CDD:400151 29/94 (31%)
Ig strand B 486..490 CDD:409570 2/3 (67%)
Ig strand C 499..503 CDD:409570 2/3 (67%)
Ig strand E 525..529 CDD:409570 1/3 (33%)
Ig strand F 539..544 CDD:409570 2/4 (50%)
Ig strand G 552..555 CDD:409570 0/2 (0%)
PTK_CCK4 686..1026 CDD:133178
tutlNP_001303307.1 V-set 138..250 CDD:462230 23/121 (19%)
I-set 253..341 CDD:400151 26/100 (26%)
Ig strand B 271..275 CDD:409353 1/3 (33%)
Ig strand C 284..288 CDD:409353 2/3 (67%)
Ig strand E 308..311 CDD:409353 1/2 (50%)
Ig strand F 321..326 CDD:409353 2/4 (50%)
Ig strand G 334..337 CDD:409353 0/2 (0%)
Ig 346..437 CDD:472250 29/132 (22%)
Ig strand B 362..366 CDD:409353 0/3 (0%)
Ig strand C 376..380 CDD:409353 1/3 (33%)
Ig strand E 402..406 CDD:409353 2/3 (67%)
Ig strand F 416..421 CDD:409353 3/4 (75%)
Ig strand G 430..433 CDD:409353 1/2 (50%)
Ig <459..530 CDD:472250 26/71 (37%)
Ig strand B 459..462 CDD:409353 1/2 (50%)
Ig strand C 471..476 CDD:409353 2/4 (50%)
Ig strand E 496..500 CDD:409353 2/3 (67%)
Ig strand F 510..515 CDD:409353 2/4 (50%)
Ig strand G 523..526 CDD:409353 1/2 (50%)
Ig_3 535..615 CDD:464046 26/82 (32%)
FN3 633..725 CDD:238020 17/82 (21%)
FN3 786..874 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.