DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk and CNTN4

DIOPT Version :10

Sequence 1:NP_523705.2 Gene:otk / 36283 FlyBaseID:FBgn0004839 Length:1033 Species:Drosophila melanogaster
Sequence 2:NP_783200.1 Gene:CNTN4 / 152330 HGNCID:2174 Length:1026 Species:Homo sapiens


Alignment Length:573 Identity:148/573 - (25%)
Similarity:200/573 - (34%) Gaps:147/573 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ENESVKFECESTDSYSELHYDWLHNGHRI--AYDKRVHQIGSNLHIEAVRRTEDVGNYVCIATNL 100
            |.:.||..|| .....:.|..|..||..:  ..|.|...:..:|.|....:|:|.|.|.|.||| 
Human    42 EEKKVKLNCE-VKGNPKPHIRWKLNGTDVDTGMDFRYSVVEGSLLINNPNKTQDAGTYQCTATN- 104

  Fly   101 ASGAREASPPAKLSVIYLESASVQ---LLGSNRNE-LLLKCHVEGASGDLEPLEIEWYRNSEKLS 161
             |.....|..|||...||::...:   .:...|.: ::|.|.....||:   |...|..|.    
Human   105 -SFGTIVSREAKLQFAYLDNFKTRTRSTVSVRRGQGMVLLCGPPPHSGE---LSYAWIFNE---- 161

  Fly   162 TWKNVQLDQHRLIIRQPGS--------EDDGLYRCTASNAAGR----------VMSKQGYVYQSS 208
             :.:.| |..|.:.::.|:        .|.|.|.|..:|....          ::...|.:.:..
Human   162 -YPSYQ-DNRRFVSQETGNLYIAKVEKSDVGNYTCVVTNTVTNHKVLGPPTPLILRNDGVMGEYE 224

  Fly   209 VKCLPRLPRRKNEKMMESWDKQTFLCRGKRGGAAGLEALPAAPEDLRIVQGPIGQSIIKEGEPTA 273
            .|...:.|                            |.:|.|                 :|....
Human   225 PKIEVQFP----------------------------ETVPTA-----------------KGATVK 244

  Fly   274 LTCLYELPDELKNQRIQLRWRK-DGKLLRQVELGGSAPIPGHSFDSGKDALLREDARLVLHKQNG 337
            |.|.     .|.|....:.||: |||           ||            .|:..|   ||.||
Human   245 LECF-----ALGNPVPTIIWRRADGK-----------PI------------ARKARR---HKSNG 278

  Fly   338 TLSFASIIASDAGQYQCQLQLEAHAPINSSPGILEVIEQLKFVPQPTSKNLELDAVVAKV----- 397
            .|...:....|||.|:|..:        :|.|......||.|..||.......|..||..     
Human   279 ILEIPNFQQEDAGLYECVAE--------NSRGKNVARGQLTFYAQPNWIQKINDIHVAMEENVFW 335

  Fly   398 HCKAQGTPTPQVQWVRDGENTTLPDHVEVDANGTLIFRNVNSEHRGNYTCLATNSQGQINATVAI 462
            .|||.|.|.|..:|:::||.....|.:::: .|||....||....|.|.|||.|..|.|.:...:
Human   336 ECKANGRPKPTYKWLKNGEPLLTRDRIQIE-QGTLNITIVNLSDAGMYQCLAENKHGVIFSNAEL 399

  Fly   463 NVV-VTPKFS--------VPPVGPIETSEQGTVVMHCQAIGDPKPTIQWDKDLKYLSENNTDRER 518
            :|: |.|.||        :..||       |.||:.|:....|||...|.|....|.||    ||
Human   400 SVIAVGPDFSRTLLKRVTLVKVG-------GEVVIECKPKASPKPVYTWKKGRDILKEN----ER 453

  Fly   519 FRFLENGTLEIRNVQVEDEGSYGCTIGNSAGLKREDVQLVVKTTGDGFAPEES 571
            ....|:|.|.|.||...|.|||.|...|..|.......||||.......|..|
Human   454 ITISEDGNLRIINVTKSDAGSYTCIATNHFGTASSTGNLVVKDPTRVMVPPSS 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otkNP_523705.2 Ig_3 31..99 CDD:464046 19/62 (31%)
Ig strand B 133..137 CDD:409353 1/3 (33%)
Ig <135..197 CDD:472250 16/79 (20%)
Ig strand C 150..154 CDD:409353 0/3 (0%)
Ig strand E 171..175 CDD:409353 1/3 (33%)
Ig strand F 185..190 CDD:409353 2/4 (50%)
Ig 265..360 CDD:472250 24/95 (25%)
Ig strand B 272..276 CDD:409571 1/3 (33%)
Ig strand C 290..294 CDD:409571 0/3 (0%)
Ig strand E 337..341 CDD:409571 2/3 (67%)
Ig strand F 351..356 CDD:409571 2/4 (50%)
Ig 395..460 CDD:409353 24/69 (35%)
Ig strand B 395..399 CDD:409353 1/8 (13%)
Ig strand C 408..412 CDD:409353 0/3 (0%)
Ig strand E 430..434 CDD:409353 3/3 (100%)
Ig strand F 444..449 CDD:409353 2/4 (50%)
Ig strand G 457..460 CDD:409353 0/2 (0%)
I-set 468..559 CDD:400151 33/98 (34%)
Ig strand B 486..490 CDD:409570 2/3 (67%)
Ig strand C 499..503 CDD:409570 0/3 (0%)
Ig strand E 525..529 CDD:409570 2/3 (67%)
Ig strand F 539..544 CDD:409570 3/4 (75%)
Ig strand G 552..555 CDD:409570 0/2 (0%)
PTK_CCK4 686..1026 CDD:133178
CNTN4NP_783200.1 Ig 25..120 CDD:472250 26/80 (33%)
Ig strand B 46..50 CDD:409435 2/3 (67%)
Ig strand C 59..63 CDD:409435 1/3 (33%)
Ig strand E 82..86 CDD:409435 1/3 (33%)
Ig strand F 97..102 CDD:409435 2/4 (50%)
Ig strand G 111..114 CDD:409435 1/2 (50%)
Ig 129..213 CDD:472250 17/92 (18%)
Ig strand B 140..144 CDD:409353 1/3 (33%)
Ig strand C 154..158 CDD:409353 0/3 (0%)
Ig strand E 177..181 CDD:409353 1/3 (33%)
Ig strand F 191..196 CDD:409353 2/4 (50%)
Ig strand G 207..210 CDD:409353 0/2 (0%)
Ig 225..313 CDD:472250 33/171 (19%)
Ig strand B 243..247 CDD:409353 1/3 (33%)
Ig strand C 256..260 CDD:409353 0/3 (0%)
Ig strand E 278..282 CDD:409353 2/3 (67%)
Ig strand F 292..297 CDD:409353 2/4 (50%)
Ig strand G 305..308 CDD:409353 0/2 (0%)
Ig 318..401 CDD:472250 26/83 (31%)
Ig strand B 333..337 CDD:143205 0/3 (0%)
Ig strand C 346..350 CDD:143205 0/3 (0%)
Ig strand E 367..371 CDD:143205 3/3 (100%)
Ig strand F 381..386 CDD:143205 2/4 (50%)
Ig strand G 394..397 CDD:143205 0/2 (0%)
Ig 406..494 CDD:472250 33/98 (34%)
Ig strand B 425..429 CDD:409353 2/3 (67%)
Ig strand C 438..442 CDD:409353 0/3 (0%)
Ig strand E 460..464 CDD:409353 2/3 (67%)
Ig strand F 474..479 CDD:409353 3/4 (75%)
Ig strand G 487..490 CDD:409353 0/2 (0%)
Ig6_Contactin-4 496..597 CDD:409439 2/11 (18%)
Ig strand A 496..502 CDD:409439 0/5 (0%)
Ig strand A' 505..510 CDD:409439 1/2 (50%)
Ig strand B 513..521 CDD:409439
Ig strand C 530..534 CDD:409439
Ig strand D 555..558 CDD:409439
Ig strand E 559..563 CDD:409439
Ig strand F 572..579 CDD:409439
Ig strand G 586..590 CDD:409439
FN3 597..690 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 685..710
FN3 703..795 CDD:238020
FN3 <764..>1014 CDD:442628
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 886..907
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.